OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FOXN2 (NM_002158) Human Mass Spec Standard

Be the first to review this product
SKU
PH309269
FOXN2 MS Standard C13 and N15-labeled recombinant protein (NP_002149)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA812353 FOXN2 mouse monoclonal antibody,clone OTI5H8 100 ul
$447.00
LY419494 Transient overexpression lysate of forkhead box N2 (FOXN2) (as WB positive control) 100 ug
$436.00

Other products for "FOXN2 or NM_002158"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209269
Predicted MW 47.2 kDa
Protein Sequence
Protein Sequence
>RC209269 protein sequence
Red=Cloning site Green=Tags(s)

MGPVIGMTPDKRAETPGAEKIAGLSQIYKMGSLPEAVDAARPKATLVDSESADDELTNLNWLHESTNLLT
NFSLGSEGLPIVSPLYDIEGDDVPSFGPACYQNPEKKSATSKPPYSFSLLIYMAIEHSPNKCLPVKEIYS
WILDHFPYFATAPTGWKNSVRHNLSLNKCFQKVERSHGKVNGKGSLWCVDPEYKPNLIQALKKQPFSSAS
SQNGSLSPHYLSSVIKQNQVRNLKESDIDAAAAMMLLNTSIEQGILECEKPLPLKTALQKKRSYGNAFHH
PSAVRLQESDSLATSIDPKEDHNYSASSMAAQRCASRSSVSSLSSVDEVYEFIPKNSHVGSDGSEGFHSE
EDTDVDYEDDPLGDSGYASQPCAKISEKGQSGKKMRKQTCQEIDEELKEAAGSLLHLAGIRTCLGSLIST
AKTQNQKQRKK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002149
RefSeq Size 5472
RefSeq ORF 1293
Synonyms HTLF
Locus ID 3344
UniProt ID P32314
Cytogenetics 2p16.3
Summary This gene encodes a forkhead domain binding protein and may function in the transcriptional regulation of the human T-cell leukemia virus long terminal repeat. provided by RefSeq, Jul 2008
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FOXN2" proteins (3)
SKU Description Size Price
LC419494 Lyophilized FOXN2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419494 Transient overexpression lysate of forkhead box N2 (FOXN2) (as WB positive control) 100 ug
$436.00
TP309269 Recombinant protein of human forkhead box N2 (FOXN2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products