OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HS3ST1 (NM_005114) Human Mass Spec Standard

Be the first to review this product
SKU
PH309256
HS3ST1 MS Standard C13 and N15-labeled recombinant protein (NP_005105)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA332073 Rabbit Polyclonal Anti-HS3ST1 Antibody
100 ul
$585.00
LY417504 Transient overexpression lysate of heparan sulfate (glucosamine) 3-O-sulfotransferase 1 (HS3ST1) (as WB positive control) 100 ug
$436.00

Other products for "HS3ST1 or NM_005114"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209256
Predicted MW 35.8 kDa
Protein Sequence
Protein Sequence
>RC209256 protein sequence
Red=Cloning site Green=Tags(s)

MAALLLGAVLLVAQPQLVPSRTAELGQQELLRKAGTLQDDVRDGVAPNGSAQQLPQTIIIGVRKGGTRAL
LEMLSLHPDVAAAENEVHFFDWEEHYSHGLGWYLSQMPFSWPHQLTVEKTPAYFTSPKVPERVYSMNPSI
RLLLILRDPSERVLSDYTQVFYNHMQKHKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHMQNWLRFFPLR
HIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPK
LLNKLHEYFHEPNKKFFELVGRTFDWH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005105
RefSeq Size 1965
RefSeq ORF 921
Synonyms 3OST; 3OST1
Locus ID 9957
UniProt ID O14792
Cytogenetics 4p15.33
Summary Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. The enzyme encoded by this gene is a member of the heparan sulfate biosynthetic enzyme family. It possesses both heparan sulfate glucosaminyl 3-O-sulfotransferase activity, anticoagulant heparan sulfate conversion activity, and is a rate limiting enzyme for synthesis of anticoagulant heparan. This enzyme is an intraluminal Golgi resident protein. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Protein Pathways Heparan sulfate biosynthesis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HS3ST1" proteins (3)
SKU Description Size Price
LC417504 Lyophilized HS3ST1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417504 Transient overexpression lysate of heparan sulfate (glucosamine) 3-O-sulfotransferase 1 (HS3ST1) (as WB positive control) 100 ug
$436.00
TP309256 Recombinant protein of human heparan sulfate (glucosamine) 3-O-sulfotransferase 1 (HS3ST1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products