IRAKM (IRAK3) (NM_007199) Human Mass Spec Standard

SKU
PH309245
IRAK3 MS Standard C13 and N15-labeled recombinant protein (NP_009130)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209245]
Predicted MW 67.8 kDa
Protein Sequence
Protein Sequence
>RC209245 protein sequence
Red=Cloning site Green=Tags(s)

MAGNCGARGALSAHTLLFDLPPALLGELCAVLDSCDGALGWRGLAERLSSSWLDVRHIEKYVDQGKSGTR
ELLWSWAQKNKTIGDLLQVLQEMGHRRAIHLITNYGAVLSPSEKSYQEGGFPNILFKETANVTVDNVLIP
EHNEKGVLLKSSISFQNIIEGTRNFHKDFLIGEGEIFEVYRVEIQNLTYAVKLFKQEKKMQCKKHWKRFL
SELEVLLLFHHPNILELAAYFTETEKFCLIYPYMRNGTLFDRLQCVGDTAPLPWHIRIGILIGISKAIHY
LHNVQPCSVICGSISSANILLDDQFQPKLTDFAMAHFRSHLEHQSCTINMTSSSSKHLWYMPEEYIRQGK
LSIKTDVYSFGIVIMEVLTGCRVVLDDPKHIQLRDLLRELMEKRGLDSCLSFLDKKVPPCPRNFSAKLFC
LAGRCAATRAKLRPSMDEVLNTLESTQASLYFAEDPPTSLKSFRCPSPLFLENVPSIPVEDDESQNNNLL
PSDEGLRIDRMTQKTPFECSQSEVMFLSLDKKPESKRNEEACNMPSSSCEESWFPKYIVPSQDLRPYKVN
IDPSSEAPGHSCRSRPVESSCSSKFSWDEYEQYKKE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_009130
RefSeq Size 8351
RefSeq ORF 1788
Synonyms ASRT5; IRAKM
Locus ID 11213
UniProt ID Q9Y616
Cytogenetics 12q14.3
Summary This gene encodes a member of the interleukin-1 receptor-associated kinase protein family. Members of this family are essential components of the Toll/IL-R immune signal transduction pathways. This protein is primarily expressed in monocytes and macrophages and functions as a negative regulator of Toll-like receptor signaling. Mutations in this gene are associated with a susceptibility to asthma. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2010]
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Apoptosis, Neurotrophin signaling pathway
Write Your Own Review
You're reviewing:IRAKM (IRAK3) (NM_007199) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402105 IRAK3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428144 IRAK3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402105 Transient overexpression lysate of interleukin-1 receptor-associated kinase 3 (IRAK3), transcript variant 1 100 ug
$436.00
LY428144 Transient overexpression lysate of interleukin-1 receptor-associated kinase 3 (IRAK3), transcript variant 2 100 ug
$436.00
TP309245 Recombinant protein of human interleukin-1 receptor-associated kinase 3 (IRAK3), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.