OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EPM2AIP1 (NM_014805) Human Mass Spec Standard

Be the first to review this product
SKU
PH309239
EPM2AIP1 MS Standard C13 and N15-labeled recombinant protein (NP_055620)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA501797 EPM2AIP1 mouse monoclonal antibody, clone OTI2G3 (formerly 2G3) 100 ul
$447.00
LY415014 Transient overexpression lysate of EPM2A (laforin) interacting protein 1 (EPM2AIP1) (as WB positive control) 100 ug
$436.00

Other products for "EPM2AIP1 or NM_014805"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC209239
Predicted MW 70.4 kDa
Protein Sequence
Protein Sequence
>RC209239 protein sequence
Red=Cloning site Green=Tags(s)

MWMTPKRSKMEVDEALVFRPEWTQRYLVVEPPEGDGALCLVCRRLIVATRERDVRRHYEAEHEYYERYVA
DGERAALVERLRQGDLPVASFTPEERAARAGLGLCRLLALKGRGWGEGDFVYQCMEVLLREVLPEHVSVL
QGVDLSPDITRQRILSIDRNLRNQLFNRARDFKAYSLALDDQAFVAYENYLLVFIRGVGPELEVQEDLLT
IINLTHHFSVGALMSAILESLQTAGLSLQRMVGLTTTHTLRMIGENSGLVSYMREKAVSPNCWNVIHYSG
FLHLELLSSYDVDVNQIINTISEWIVLIKTRGVRRPEFQTLLTESESEHGERVNGRCLNNWLRRGKTLKL
IFSLRKEMEAFLVSVGATTVHFSDKQWLCDFGFLVDIMEHLRELSEELRVSKVFAAAAFDHICTFEVKLN
LFQRHIEEKNLTDFPALREVVDELKQQNKEDEKIFDPDRYQMVICRLQKEFERHFKDLRFIKKDLELFSN
PFNFKPEYAPISVRVELTKLQANTNLWNEYRIKDLGQFYAGLSAESYPIIKGVACKVASLFDSNQICEKA
FSYLTRNQHTLSQPLTDEHLQALFRVATTEMEPGWDDLVRERNESNP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055620
RefSeq Size 7439
RefSeq ORF 1821
Locus ID 9852
UniProt ID Q7L775
Cytogenetics 3p22.2
Summary The EPM2A gene, which encodes laforin, is mutated in an autosomal recessive form of adolescent progressive myoclonus epilepsy. The protein encoded by this gene binds to laforin, but its function is not known. This gene is intronless. provided by RefSeq, Oct 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EPM2AIP1" proteins (3)
SKU Description Size Price
LC415014 Lyophilized EPM2AIP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415014 Transient overexpression lysate of EPM2A (laforin) interacting protein 1 (EPM2AIP1) (as WB positive control) 100 ug
$436.00
TP309239 Recombinant protein of human EPM2A (laforin) interacting protein 1 (EPM2AIP1), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products