ZADH1 (PTGR2) (NM_152444) Human Mass Spec Standard

SKU
PH309182
PTGR2 MS Standard C13 and N15-labeled recombinant protein (NP_689657)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209182]
Predicted MW 38.5 kDa
Protein Sequence
Protein Sequence
>RC209182 protein sequence
Red=Cloning site Green=Tags(s)

MIVQRVVLNSRPGKNGNPVAENFRMEEVYLPDNINEGQVQVRTLYLSVDPYMRCRMNEDTGTDYITPWQL
SQVVDGGGIGIIEESKHTNLTKGDFVTSFYWPWQTKVILDGNSLEKVDPQLVDGHLSYFLGAIGMPGLTS
LIGIQEKGHITAGSNKTMVVSGAAGACGSVAGQIGHFLGCSRVVGICGTHEKCILLTSELGFDAAINYKK
DNVAEQLRESCPAGVDVYFDNVGGNISDTVISQMNENSHIILCGQISQYNKDVPYPPPLSPAIEAIQKER
NITRERFLVLNYKDKFEPGILQLSQWFKEGKLKIKETVINGLENMGAAFQSMMTGGNIGKQIVCISEEIS
L

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_689657
RefSeq Size 2610
RefSeq ORF 1053
Synonyms HEL-S-298; PGR2; ZADH1
Locus ID 145482
UniProt ID Q8N8N7
Cytogenetics 14q24.3
Summary This gene encodes an enzyme involved in the metabolism of prostaglandins. The encoded protein catalyzes the NADPH-dependent conversion of 15-keto-prostaglandin E2 to 15-keto-13,14-dihydro-prostaglandin E2. This protein may also be involved in regulating activation of the peroxisome proliferator-activated receptor. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:ZADH1 (PTGR2) (NM_152444) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403472 PTGR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431866 PTGR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431867 PTGR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403472 Transient overexpression lysate of prostaglandin reductase 2 (PTGR2), transcript variant 1 100 ug
$436.00
LY431866 Transient overexpression lysate of prostaglandin reductase 2 (PTGR2), transcript variant 2 100 ug
$436.00
LY431867 Transient overexpression lysate of prostaglandin reductase 2 (PTGR2), transcript variant 3 100 ug
$436.00
TP309182 Recombinant protein of human prostaglandin reductase 2 (PTGR2), 20 µg 20 ug
$737.00
TP328838 Recombinant protein of human prostaglandin reductase 2 (PTGR2), transcript variant 2, 20 µg 20 ug
$737.00
TP328839 Recombinant protein of human prostaglandin reductase 2 (PTGR2), transcript variant 3, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.