ZADH1 (PTGR2) (NM_152444) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC209182] |
Predicted MW | 38.5 kDa |
Protein Sequence |
Protein Sequence
>RC209182 protein sequence
Red=Cloning site Green=Tags(s) MIVQRVVLNSRPGKNGNPVAENFRMEEVYLPDNINEGQVQVRTLYLSVDPYMRCRMNEDTGTDYITPWQL SQVVDGGGIGIIEESKHTNLTKGDFVTSFYWPWQTKVILDGNSLEKVDPQLVDGHLSYFLGAIGMPGLTS LIGIQEKGHITAGSNKTMVVSGAAGACGSVAGQIGHFLGCSRVVGICGTHEKCILLTSELGFDAAINYKK DNVAEQLRESCPAGVDVYFDNVGGNISDTVISQMNENSHIILCGQISQYNKDVPYPPPLSPAIEAIQKER NITRERFLVLNYKDKFEPGILQLSQWFKEGKLKIKETVINGLENMGAAFQSMMTGGNIGKQIVCISEEIS L myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_689657 |
RefSeq Size | 2610 |
RefSeq ORF | 1053 |
Synonyms | HEL-S-298; PGR2; ZADH1 |
Locus ID | 145482 |
UniProt ID | Q8N8N7 |
Cytogenetics | 14q24.3 |
Summary | This gene encodes an enzyme involved in the metabolism of prostaglandins. The encoded protein catalyzes the NADPH-dependent conversion of 15-keto-prostaglandin E2 to 15-keto-13,14-dihydro-prostaglandin E2. This protein may also be involved in regulating activation of the peroxisome proliferator-activated receptor. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009] |
Protein Families | Druggable Genome |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC403472 | PTGR2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC431866 | PTGR2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC431867 | PTGR2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY403472 | Transient overexpression lysate of prostaglandin reductase 2 (PTGR2), transcript variant 1 | 100 ug |
$436.00
|
|
LY431866 | Transient overexpression lysate of prostaglandin reductase 2 (PTGR2), transcript variant 2 | 100 ug |
$436.00
|
|
LY431867 | Transient overexpression lysate of prostaglandin reductase 2 (PTGR2), transcript variant 3 | 100 ug |
$436.00
|
|
TP309182 | Recombinant protein of human prostaglandin reductase 2 (PTGR2), 20 µg | 20 ug |
$737.00
|
|
TP328838 | Recombinant protein of human prostaglandin reductase 2 (PTGR2), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP328839 | Recombinant protein of human prostaglandin reductase 2 (PTGR2), transcript variant 3, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.