Dystrophia myotonica protein kinase (DMPK) (NM_004409) Human Mass Spec Standard

SKU
PH309151
DMPK MS Standard C13 and N15-labeled recombinant protein (NP_004400)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209151]
Predicted MW 69.4 kDa
Protein Sequence
Protein Sequence
>RC209151 protein sequence
Red=Cloning site Green=Tags(s)

MSAEVRLRRLQQLVLDPGFLGLEPLLDLLLGVHQELGASELAQDKYVADFLQWAEPIVVRLKEVRLQRDD
FEILKVIGRGAFSEVAVVKMKQTGQVYAMKIMNKWDMLKRGEVSCFREERDVLVNGDRRWITQLHFAFQD
ENYLYLVMEYYVGGDLLTLLSKFGERIPAEMARFYLAEIVMAIDSVHRLGYVHRDIKPDNILLDRCGHIR
LADFGSCLKLRADGTVRSLVAVGTPDYLSPEILQAVGGGPGTGSYGPECDWWALGVFAYEMFYGQTPFYA
DSTAETYGKIVHYKEHLSLPLVDEGVPEEARDFIQRLLCPPETRLGRGGAGDFRTHPFFFGLDWDGLRDS
VPPFTPDFEGATDTCNFDLVEDGLTAMVSGGGETLSDIREGAPLGVHLPFVGYSYSCMALRDSEVPGPTP
MELEAEQLLEPHVQAPSLEPSVSPQDETAEVAVPAAVPAAEAEAEVTLRELQEALEEEVLTRQSLSREME
AIRTDNQNFASQLREAEARNRDLEAHVRQLQERMELLQAEGATAVTGVPSPRATDPPSHLDGPPAVAVGQ
CPLVGPGPMHRRHLLLPARVPRPGLSEALSLLLFAVVLSRAAALGCIGLVAHAGQLTAVWRRPGAARAP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004400
RefSeq Size 2874
RefSeq ORF 1887
Synonyms DM; DM1; DM1PK; DMK; MDPK; MT-PK
Locus ID 1760
UniProt ID Q09013
Cytogenetics 19q13.32
Summary The protein encoded by this gene is a serine-threonine kinase that is closely related to other kinases that interact with members of the Rho family of small GTPases. Substrates for this enzyme include myogenin, the beta-subunit of the L-type calcium channels, and phospholemman. The 3' untranslated region of this gene contains 5-38 copies of a CTG trinucleotide repeat. Expansion of this unstable motif to 50-5,000 copies causes myotonic dystrophy type I, which increases in severity with increasing repeat element copy number. Repeat expansion is associated with condensation of local chromatin structure that disrupts the expression of genes in this region. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Jul 2016]
Protein Families Druggable Genome, Protein Kinase
Write Your Own Review
You're reviewing:Dystrophia myotonica protein kinase (DMPK) (NM_004409) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH323643 DMPK MS Standard C13 and N15-labeled recombinant protein (NP_001075031) 10 ug
$3,255.00
LC418004 DMPK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421164 DMPK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421165 DMPK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418004 Transient overexpression lysate of dystrophia myotonica-protein kinase (DMPK), transcript variant 2 100 ug
$436.00
LY421164 Transient overexpression lysate of dystrophia myotonica-protein kinase (DMPK), transcript variant 3 100 ug
$665.00
LY421165 Transient overexpression lysate of dystrophia myotonica-protein kinase (DMPK), transcript variant 4 100 ug
$665.00
TP309151 Recombinant protein of human dystrophia myotonica-protein kinase (DMPK), transcript variant 2, 20 µg 20 ug
$737.00
TP323643 Recombinant protein of human dystrophia myotonica-protein kinase (DMPK), transcript variant 4, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.