CSN1 (GPS1) (NM_212492) Human Mass Spec Standard

SKU
PH309147
GPS1 MS Standard C13 and N15-labeled recombinant protein (NP_997657)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209147]
Predicted MW 59.1 kDa
Protein Sequence
Protein Sequence
>RC209147 protein sequence
Red=Cloning site Green=Tags(s)

MRDSSAPSSASSSVTDLYCTPHSSRSDLVLPGTAGDFSLSASLSACTLLYEGAVEPMQIDVDPQEDPQNA
PDVNYVVENPSLDLEQYAASYSGLMRIERLQFIADHCPTLRVEALKMALSFVQRTFNVDMYEEIHRKLSE
ATRELQNAPDAIPESGVEPPALDTAWVEATRKKALLKLEKLDTDLKNYKGNSIKESIRRGHDDLGDHYLD
CGDLSNALKCYSRARDYCTSAKHVINMCLNVIKVSVYLQNWSHVLSYVSKAESTPEIAEQRGERDSQTQA
ILTKLKCAAGLAELAARKYKQAAKCLLLASFDHCDFPELLSPSNVAIYGGLCALATFDRQELQRNVISSS
SFKLFLELEPQVRDIIFKFYESKYASCLKMLDEMKDNLLLDMYLAPHVRTLYTQIRNRALIQYFSPYVSA
DMHRMAAAFNTTVAALEDELTQLILEGLISARVDSHSKILYARDVDQRSTTFEKSLLMGKEFQRRAKAMM
LRAAVLRNQIHVKSPPREGSQGELTPANSQSRMSTNM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_997657
RefSeq Size 2363
RefSeq ORF 1581
Synonyms COPS1; CSN1; SGN1
Locus ID 2873
UniProt ID Q13098
Cytogenetics 17q25.3
Summary This gene is known to suppress G-protein and mitogen-activated signal transduction in mammalian cells. The encoded protein shares significant similarity with Arabidopsis FUS6, which is a regulator of light-mediated signal transduction in plant cells. [provided by RefSeq, Mar 2016]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:CSN1 (GPS1) (NM_212492) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403953 GPS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC418202 GPS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403953 Transient overexpression lysate of G protein pathway suppressor 1 (GPS1), transcript variant 1 100 ug
$436.00
LY418202 Transient overexpression lysate of G protein pathway suppressor 1 (GPS1), transcript variant 2 100 ug
$436.00
TP309147 Recombinant protein of human G protein pathway suppressor 1 (GPS1), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.