BACE1 (NM_012104) Human Mass Spec Standard

SKU
PH309115
BACE1 MS Standard C13 and N15-labeled recombinant protein (NP_036236)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209115]
Predicted MW 55.8 kDa
Protein Sequence
Protein Sequence
>RC209115 protein sequence
Red=Cloning site Green=Tags(s)

MAQALPWLLLWMGAGVLPAHGTQHGIRLPLRSGLGGAPLGLRLPRETDEEPEEPGRRGSFVEMVDNLRGK
SGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTYRDLRKGVYVPYTQGKWEGE
LGTDLVSIPHGPNVTVRANIAAITESDKFFINGSNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHVPNL
FSLQLCGAGFPLNQSEVLASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKE
YNYDKSIVDSGTTNLRLPKKVFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMG
EVTNQSFRITILPQQYLRPVEDVATSQDDCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFAVSAC
HVHDEFRTAAVEGPFVTLDMEDCGYNIPQTDESTLMTIAYVMAAICALFMLPLCLMVCQWRCLRCLRQQH
DDFADDISLLK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036236
RefSeq Size 5864
RefSeq ORF 1503
Synonyms ASP2; BACE; HSPC104
Locus ID 23621
UniProt ID P56817
Cytogenetics 11q23.3
Summary This gene encodes a member of the peptidase A1 family of aspartic proteases. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protease. This transmembrane protease catalyzes the first step in the formation of amyloid beta peptide from amyloid precursor protein. Amyloid beta peptides are the main constituent of amyloid beta plaques, which accumulate in the brains of human Alzheimer's disease patients. [provided by RefSeq, Nov 2015]
Protein Families Druggable Genome, Protease, Transmembrane
Protein Pathways Alzheimer's disease
Write Your Own Review
You're reviewing:BACE1 (NM_012104) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402147 BACE1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC408446 BACE1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC408448 BACE1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC430074 BACE1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402147 Transient overexpression lysate of beta-site APP-cleaving enzyme 1 (BACE1), transcript variant a 100 ug
$436.00
LY408446 Transient overexpression lysate of beta-site APP-cleaving enzyme 1 (BACE1), transcript variant c 100 ug
$665.00
LY408448 Transient overexpression lysate of beta-site APP-cleaving enzyme 1 (BACE1), transcript variant d 100 ug
$665.00
LY430074 Transient overexpression lysate of beta-site APP-cleaving enzyme 1 (BACE1), transcript variant c 100 ug
$436.00
TP309115 Recombinant protein of human beta-site APP-cleaving enzyme 1 (BACE1), transcript variant a, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.