carabin (TBC1D10C) (NM_198517) Human Mass Spec Standard

SKU
PH309092
TBC1D10C MS Standard C13 and N15-labeled recombinant protein (NP_940919)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209092]
Predicted MW 49.7 kDa
Protein Sequence
Protein Sequence
>RC209092 protein sequence
Red=Cloning site Green=Tags(s)

MAQALGEDLVQPPELQDDSSSLGSDSELSGPGPYRQADRYGFIGGSSAEPGPGHPPADLIRQREMKWVEM
TSHWEKTMSRRYKKVKMQCRKGIPSALRARCWPLLCGAHVCQKNSPGTYQELAEAPGDPQWMETIGRDLH
RQFPLHEMFVSPQGHGQQGLLQVLKAYTLYRPEQGYCQAQGPVAAVLLMHLPPEEAFWCLVQICEVYLPG
YYGPHMEAVRLDAEVFMALLRRLLPHVHKHLQQVGVGPLLYLPEWFLCLFARSLPFPTVLRVWDAFLSEG
ARVLFRVGLTLVRLALGTAEQRGACPGLLETLGALRAIPPAQLQEEAFMSQVHSVVLSERDLQREIKAQL
AQLPDSAPGPPPRPQVRLAGAQAIFEAQQLAGVRRGAKPEVPRIVVQPPEEPRPPRRKPQTRGKTFHGLL
TRARGPPIEGPPRPQRGSTSFLDTRF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_940919
RefSeq Size 1752
RefSeq ORF 1338
Synonyms CARABIN; EPI64C
Locus ID 374403
UniProt ID Q8IV04
Cytogenetics 11q13.2
Summary The protein encoded by this gene has an N-terminal Rab-GTPase domain and a binding site at the C-terminus for calcineurin, and is an inhibitor of both the Ras signaling pathway and calcineurin, a phosphatase regulated by calcium and calmodulin. Genes encoding similar proteins are located on chromosomes 16 and 22. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2013]
Write Your Own Review
You're reviewing:carabin (TBC1D10C) (NM_198517) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC404903 TBC1D10C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404903 Transient overexpression lysate of TBC1 domain family, member 10C (TBC1D10C) 100 ug
$436.00
TP309092 Recombinant protein of human TBC1 domain family, member 10C (TBC1D10C), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.