RGS19 (NM_005873) Human Mass Spec Standard

SKU
PH309082
RGS19 MS Standard C13 and N15-labeled recombinant protein (NP_005864)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209082]
Predicted MW 24.6 kDa
Protein Sequence
Protein Sequence
>RC209082 protein sequence
Red=Cloning site Green=Tags(s)

MPTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSWNQERRRAWQASRESKLQPL
PSCEVCATPSPEEVQSWAQSFDKLMHSPAGRSVFRAFLRTEYSEENMLFWLACEELKAEANQHVVDEKAR
LIYEDYVSILSPKEVSLDSRVREGINKKMQEPSAHTFDDAQLQIYTLMHRDSYPRFLSSPTYRALLLQGP
SQSSSEA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005864
RefSeq Size 1593
RefSeq ORF 651
Synonyms GAIP; RGSGAIP
Locus ID 10287
UniProt ID P49795
Cytogenetics 20q13.33
Summary G proteins mediate a number of cellular processes. The protein encoded by this gene belongs to the RGS (regulators of G-protein signaling) family and specifically interacts with G protein, GAI3. This protein is a guanosine triphosphatase-activating protein that functions to down-regulate Galpha i/Galpha q-linked signaling. Alternatively spliced transcript variants encoding the same protein isoform have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:RGS19 (NM_005873) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH301715 RGS19 MS Standard C13 and N15-labeled recombinant protein (NP_001034556) 10 ug
$3,255.00
LC417015 RGS19 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422051 RGS19 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417015 Transient overexpression lysate of regulator of G-protein signaling 19 (RGS19), transcript variant 1 100 ug
$436.00
LY422051 Transient overexpression lysate of regulator of G-protein signaling 19 (RGS19), transcript variant 2 100 ug
$436.00
TP301715 Recombinant protein of human regulator of G-protein signaling 19 (RGS19), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP309082 Recombinant protein of human regulator of G-protein signaling 19 (RGS19), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.