LIS1 (PAFAH1B1) (NM_000430) Human Mass Spec Standard

SKU
PH309055
PAFAH1B1 MS Standard C13 and N15-labeled recombinant protein (NP_000421)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209055]
Predicted MW 46.5 kDa
Protein Sequence
Protein Sequence
>RC209055 representing NM_000430
Red=Cloning site Green=Tags(s)

MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGLLEKKWTSVIRLQKKVMELES
KLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETG
DFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSA
SRDKTIKMWEVQTGYCVKTFTGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVE
CISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGG
KFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000421
RefSeq Size 5581
RefSeq ORF 1230
Synonyms LIS1; LIS2; MDCR; MDS; NudF; PAFAH
Locus ID 5048
UniProt ID P43034
Cytogenetics 17p13.3
Summary This locus was identified as encoding a gene that when mutated or lost caused the lissencephaly associated with Miller-Dieker lissencephaly syndrome. This gene encodes the non-catalytic alpha subunit of the intracellular Ib isoform of platelet-activating factor acteylhydrolase, a heterotrimeric enzyme that specifically catalyzes the removal of the acetyl group at the SN-2 position of platelet-activating factor (identified as 1-O-alkyl-2-acetyl-sn-glyceryl-3-phosphorylcholine). Two other isoforms of intracellular platelet-activating factor acetylhydrolase exist: one composed of multiple subunits, the other, a single subunit. In addition, a single-subunit isoform of this enzyme is found in serum. [provided by RefSeq, Apr 2009]
Protein Pathways Ether lipid metabolism, Metabolic pathways
Write Your Own Review
You're reviewing:LIS1 (PAFAH1B1) (NM_000430) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC424722 PAFAH1B1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY424722 Transient overexpression lysate of platelet-activating factor acetylhydrolase, isoform Ib, subunit 1 (45kDa) (PAFAH1B1) 100 ug
$436.00
TP309055 Recombinant protein of human platelet-activating factor acetylhydrolase, isoform Ib, alpha subunit 45kDa (PAFAH1B1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.