ATP6V0D2 (NM_152565) Human Mass Spec Standard

SKU
PH309007
ATP6V0D2 MS Standard C13 and N15-labeled recombinant protein (NP_689778)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209007]
Predicted MW 40.4 kDa
Protein Sequence
Protein Sequence
>RC209007 protein sequence
Red=Cloning site Green=Tags(s)

MLEGAELYFNVDHGYLEGLVRGCKASLLTQQDYINLVQCETLEDLKIHLQTTDYGNFLANHTNPLTVSKI
DTEMRKRLCGEFEYFRNHSLEPLSTFLTYMTCSYMIDNVILLMNGALQKKSVKEILGKCHPLGRFTEMEA
VNIAETPSDLFNAILIETPLAPFFQDCMSENALDELNIELLRNKLYKSYLEAFYKFCKNHGDVTAEVMCP
ILEFEADRRAFIITLNSFGTELSKEDRETLYPTFGKLYPEGLRLLAQAEDFDQMKNVADHYGVYKPLFEA
VGGSGGKTLEDVFYEREVQMNVLAFNRQFHYGVFYAYVKLKEQEIRNIVWIAECISQRHRTKINSYIPIL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_689778
RefSeq Size 2370
RefSeq ORF 1050
Synonyms ATP6D2; VMA6
Locus ID 245972
UniProt ID Q8N8Y2
Cytogenetics 8q21.3
Summary Subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. May play a role in coupling of proton transport and ATP hydrolysis (By similarity).[UniProtKB/Swiss-Prot Function]
Protein Pathways Epithelial cell signaling in Helicobacter pylori infection, Lysosome, Metabolic pathways, Oxidative phosphorylation, Vibrio cholerae infection
Write Your Own Review
You're reviewing:ATP6V0D2 (NM_152565) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403477 ATP6V0D2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403477 Transient overexpression lysate of ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2 (ATP6V0D2) 100 ug
$436.00
TP309007 Recombinant protein of human ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2 (ATP6V0D2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.