Apolipoprotein CI (APOC1) (NM_001645) Human Mass Spec Standard

SKU PH308888

APOC1 MS Standard C13 and N15-labeled recombinant protein (NP_001636)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC208888]
• Predicted MW: 9.3 kDa
• Protein Sequence:
  Protein Sequence

  >RC208888 protein sequence; Red=Cloning site Green=Tags(s); ; MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSE; TFQKVKEKLKIDS; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001636
• RefSeq Size: 464
• RefSeq ORF: 249
• Synonyms: Apo-CI; apo-CIB; ApoC-I; apoC-IB
• Locus ID: 341
• UniProt ID: P02654
• Cytogenetics: 19q13.32
• Summary: This gene encodes a member of the apolipoprotein C1 family. This gene is expressed primarily in the liver, and it is activated when monocytes differentiate into macrophages. The encoded protein plays a central role in high density lipoprotein (HDL) and very low density lipoprotein (VLDL) metabolism. This protein has also been shown to inhibit cholesteryl ester transfer protein in plasma. A pseudogene of this gene is located 4 kb downstream in the same orientation, on the same chromosome. This gene is mapped to chromosome 19, where it resides within a apolipoprotein gene cluster. Alternative splicing and the use of alternative promoters results in multiple transcript variants. [provided by RefSeq, Sep 2016]
• Protein Families: Secreted Protein