OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EMG1 (NM_006331) Human Mass Spec Standard

Be the first to review this product
SKU
PH308885
EMG1 MS Standard C13 and N15-labeled recombinant protein (NP_006322)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA501209 Anti-EMG1 mouse monoclonal antibody, clone OTI1B8 (formerly 1B8) 100 ul
$447.00
LY401906 Transient overexpression lysate of EMG1 nucleolar protein homolog (S. cerevisiae) (EMG1) (as WB positive control) 100 ug
$436.00

Other products for "EMG1 or NM_006331"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208885
Predicted MW 26.7 kDa
Protein Sequence
Protein Sequence
>RC208885 protein sequence
Red=Cloning site Green=Tags(s)

MAAPSDGFKPRERSGGEQAQDWDALPPKRPRLGAGNKIGGRRLIVVLEGASLETVKVGKTYELLNCDKHK
SILLKNGRDPGEARPDITHQSLLMLMDSPLNRAGLLQVYIHTQKNVLIEVNPQTRIPRTFDRFCGLMVQL
LHKLSVRAADGPQKLLKVIKNPVSDHFPVGCMKVGTSFSIPVVSDVRELVPSSDPIVFVVGAFAHGKVSV
EYTEKMVSISNYPLSAALTCAKLTTAFEEVWGVI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006322
RefSeq Size 1072
RefSeq ORF 732
Synonyms C2F; Grcc2f; NEP1
Locus ID 10436
UniProt ID Q92979
Cytogenetics 12p13.31
Summary This gene encodes an essential, conserved eukaryotic protein that methylates pseudouridine in 18S rRNA. The related protein in yeast is a component of the small subunit processome and is essential for biogenesis of the ribosomal 40S subunit. A mutation in this gene has been associated with Bowen-Conradi syndrome. Alternative splicing results in multiple transcript variants. provided by RefSeq, Feb 2016
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EMG1" proteins (3)
SKU Description Size Price
LC401906 Lyophilized EMG1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401906 Transient overexpression lysate of EMG1 nucleolar protein homolog (S. cerevisiae) (EMG1) (as WB positive control) 100 ug
$436.00
TP308885 Recombinant protein of human EMG1 nucleolar protein homolog (S. cerevisiae) (EMG1), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products