EMG1 (NM_006331) Human Mass Spec Standard

SKU
PH308885
EMG1 MS Standard C13 and N15-labeled recombinant protein (NP_006322)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208885]
Predicted MW 26.7 kDa
Protein Sequence
Protein Sequence
>RC208885 protein sequence
Red=Cloning site Green=Tags(s)

MAAPSDGFKPRERSGGEQAQDWDALPPKRPRLGAGNKIGGRRLIVVLEGASLETVKVGKTYELLNCDKHK
SILLKNGRDPGEARPDITHQSLLMLMDSPLNRAGLLQVYIHTQKNVLIEVNPQTRIPRTFDRFCGLMVQL
LHKLSVRAADGPQKLLKVIKNPVSDHFPVGCMKVGTSFSIPVVSDVRELVPSSDPIVFVVGAFAHGKVSV
EYTEKMVSISNYPLSAALTCAKLTTAFEEVWGVI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006322
RefSeq Size 1072
RefSeq ORF 732
Synonyms C2F; Grcc2f; NEP1
Locus ID 10436
UniProt ID Q92979
Cytogenetics 12p13.31
Summary This gene encodes an essential, conserved eukaryotic protein that methylates pseudouridine in 18S rRNA. The related protein in yeast is a component of the small subunit processome and is essential for biogenesis of the ribosomal 40S subunit. A mutation in this gene has been associated with Bowen-Conradi syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]
Write Your Own Review
You're reviewing:EMG1 (NM_006331) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401906 EMG1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401906 Transient overexpression lysate of EMG1 nucleolar protein homolog (S. cerevisiae) (EMG1) 100 ug
$436.00
TP308885 Recombinant protein of human EMG1 nucleolar protein homolog (S. cerevisiae) (EMG1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.