FOXQ1 (NM_033260) Human Mass Spec Standard

SKU
PH308831
FOXQ1 MS Standard C13 and N15-labeled recombinant protein (NP_150285)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208831]
Predicted MW 41.3 kDa
Protein Sequence
Protein Sequence
>RC208831 representing NM_033260
Red=Cloning site Green=Tags(s)

MKLEVFVPRAAHGDKQGSDLEGAGGSDAPSPLSAAGDDSLGSDGDCAANSPAAGGGARDPPGDGEQSAGG
GPGAEEAIPAAAAAAVVAEGAEAGAAGPGAGGAGSGEGARSKPYTRRPKPPYSYIALIAMAIRDSAGGRL
TLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNPNSEYTFADGVFR
RRRKRLSHRAPVPAPGLRPEEAPGLPAAPPPAPAAPASPRMRSPARQEERASPAGKFSSSFAIDSILRKP
FRSRRLRDTAPGTTLQWGAAPCPPLPAFPALLPAAPCRALLPLCAYGAGEPARLGAREAEVPPTAPPLLL
APLPAAAPAKPLRGPAAGGAHLYCPLRLPAALQAASVRRPGPHLPYPVETLLA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_150285
RefSeq Size 2322
RefSeq ORF 1209
Synonyms HFH1
Locus ID 94234
UniProt ID Q9C009
Cytogenetics 6p25.3
Summary FOXQ1 is a member of the FOX gene family, which is characterized by a conserved 110-amino acid DNA-binding motif called the forkhead or winged helix domain. FOX genes are involved in embryonic development, cell cycle regulation, tissue-specific gene expression, cell signaling, and tumorigenesis (Bieller et al., 2001 [PubMed 11747606]).[supplied by OMIM, May 2009]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:FOXQ1 (NM_033260) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC409634 FOXQ1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409634 Transient overexpression lysate of forkhead box Q1 (FOXQ1) 100 ug
$436.00
TP308831 Recombinant protein of human forkhead box Q1 (FOXQ1), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.