DCUN1D4 (NM_015115) Human Mass Spec Standard

SKU
PH308821
DCUN1D4 MS Standard C13 and N15-labeled recombinant protein (NP_055930)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208821]
Predicted MW 30 kDa
Protein Sequence
Protein Sequence
>RC208821 protein sequence
Red=Cloning site Green=Tags(s)

MHSDAAAVNFQLNSHLSTLANIHKIYHTLNKLNLTEDIGQDDHQTGSLRSCSSSDCFNKVMPPRKKRRPA
SGDDLSAKKSRHDSMYRKYDSTRIKTEEEAFSSKRCLEWFYEYAGTDDVVGPEGMEKFCEDIGVEPENVV
MLVLAWKLDAQNMGYFTLQEWLKGMTSLQCDTTEKLRNTLDYLRSFLNDSTNFKLIYRYAFDFARQSKYK
VINKDQWCNVLEFSRTINLDLSNYDEDGAWPVLLDEFVEWYKDKQMS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055930
RefSeq Size 4283
RefSeq ORF 771
Locus ID 23142
UniProt ID Q92564
Cytogenetics 4q12
Summary Contributes to the neddylation of all cullins by transfering NEDD8 from N-terminally acetylated NEDD8-conjugating E2s enzyme to different cullin C-terminal domain-RBX complexes which are necessary for the activation of cullin-RING E3 ubiquitin ligases (CRLs).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:DCUN1D4 (NM_015115) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414778 DCUN1D4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421741 DCUN1D4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414778 Transient overexpression lysate of DCN1, defective in cullin neddylation 1, domain containing 4 (S. cerevisiae) (DCUN1D4), transcript variant 2 100 ug
$436.00
LY421741 Transient overexpression lysate of DCN1, defective in cullin neddylation 1, domain containing 4 (S. cerevisiae) (DCUN1D4), transcript variant 1 100 ug
$436.00
TP308821 Recombinant protein of human DCN1, defective in cullin neddylation 1, domain containing 4 (S. cerevisiae) (DCUN1D4), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.