RHOC (NM_001042678) Human Mass Spec Standard

SKU
PH308751
RHOC MS Standard C13 and N15-labeled recombinant protein (NP_001036143)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208751]
Predicted MW 22 kDa
Protein Sequence
Protein Sequence
>RC208751 protein sequence
Red=Cloning site Green=Tags(s)

MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLR
PLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVR
SEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001036143
RefSeq Size 1346
RefSeq ORF 579
Synonyms ARH9; ARHC; H9; RHOH9
Locus ID 389
UniProt ID P08134
Cytogenetics 1p13.2
Summary This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:RHOC (NM_001042678) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH300332 RHOC MS Standard C13 and N15-labeled recombinant protein (NP_001036144) 10 ug
$3,255.00
PH317556 RHOC MS Standard C13 and N15-labeled recombinant protein (NP_786886) 10 ug
$3,255.00
LC403579 RHOC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421019 RHOC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421020 RHOC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403579 Transient overexpression lysate of ras homolog gene family, member C (RHOC), transcript variant 1 100 ug
$436.00
LY421019 Transient overexpression lysate of ras homolog gene family, member C (RHOC), transcript variant 2 100 ug
$436.00
LY421020 Transient overexpression lysate of ras homolog gene family, member C (RHOC), transcript variant 3 100 ug
$436.00
TP300332 Recombinant protein of human ras homolog gene family, member C (RHOC), transcript variant 3, 20 µg 20 ug
$737.00
TP308751 Recombinant protein of human ras homolog gene family, member C (RHOC), transcript variant 2, 20 µg 20 ug
$737.00
TP317556 Recombinant protein of human ras homolog gene family, member C (RHOC), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.