GALNS (NM_000512) Human Mass Spec Standard

SKU
PH308708
GALNS MS Standard C13 and N15-labeled recombinant protein (NP_000503)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208708]
Predicted MW 58 kDa
Protein Sequence
Protein Sequence
>RC208708 protein sequence
Red=Cloning site Green=Tags(s)

MAAVVAATRWWQLLLVLSAAGMGASGAPQPPNILLLLMDDMGWGDLGVYGEPSRETPNLDRMAAEGLLFP
NFYSANPLCSPSRAALLTGRLPIRNGFYTTNAHARNAYTPQEIVGGIPDSEQLLPELLKKAGYVSKIVGK
WHLGHRPQFHPLKHGFDEWFGSPNCHFGPYDNKARPNIPVYRDWEMVGRYYEEFPINLKTGEANLTQIYL
QEALDFIKRQARHHPFFLYWAVDATHAPVYASKPFLGTSQRGRYGDAVREIDDSIGKILELLQDLHVADN
TFVFFTSDNGAALISAPEQGGSNGPFLCGKQTTFEGGMREPALAWWPGHVTAGQVSHQLGSIMDLFTTSL
ALAGLTPPSDRAIDGLNLLPTLLQGRLMDRPIFYYRGDTLMAATLGQHKAHFWTWTNSWENFRQGIDFCP
GQNVSGVTTHNLEDHTKLPLIFHLGRDPGERFPLSFASAEYQEALSRITSVVQQHQEALVPAQPQLNVCN
WAVMNWAPPGCEKLGKCLTPPESIPKKCLWSH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000503
RefSeq Size 2380
RefSeq ORF 1566
Synonyms GalN6S; GALNAC6S; GAS; MPS4A
Locus ID 2588
UniProt ID P34059
Cytogenetics 16q24.3
Summary This gene encodes N-acetylgalactosamine-6-sulfatase which is a lysosomal exohydrolase required for the degradation of the glycosaminoglycans, keratan sulfate, and chondroitin 6-sulfate. Sequence alterations including point, missense and nonsense mutations, as well as those that affect splicing, result in a deficiency of this enzyme. Deficiencies of this enzyme lead to Morquio A syndrome, a lysosomal storage disorder. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Glycosaminoglycan degradation, Lysosome, Metabolic pathways
Write Your Own Review
You're reviewing:GALNS (NM_000512) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC424670 GALNS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY424670 Transient overexpression lysate of galactosamine (N-acetyl)-6-sulfate sulfatase (GALNS) 100 ug
$436.00
TP308708 Recombinant protein of human galactosamine (N-acetyl)-6-sulfate sulfatase (GALNS), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.