WDR58 (THOC6) (NM_024339) Human Mass Spec Standard

SKU
PH308694
THOC6 MS Standard C13 and N15-labeled recombinant protein (NP_077315)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208694]
Predicted MW 37.5 kDa
Protein Sequence
Protein Sequence
>RC208694 protein sequence
Red=Cloning site Green=Tags(s)

MERAVPLAVPLGQTEVFQALQRLHMTIFSQSVSPCGKFLAAGNNYGQIAIFSLSSALSSEAKEESKKPVV
TFQAHDGPVYSMVSTDRHLLSAGDGEVKAWLWAEMLKKGCKELWRRQPPYRTSLEVPEINALLLVPKENS
LILAGGDCQLHTMDLETGTFTRVLRGHTDYIHCLALRERSPEVLSGGEDGAVRLWDLRTAKEVQTIEVYK
HEECSRPHNGRWIGCLATDSDWMVCGGGPALTLWHLRSSTPTTIFPIRAPQKHVTFYQDLILSAGQGRCV
NQWQLSGELKAQVPGSSPGLLSLSLNQQPAAPECKVLTAAGNSCRVDVFTNLGYRAFSLSF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_077315
RefSeq Size 1444
RefSeq ORF 1023
Synonyms fSAP35; WDR58
Locus ID 79228
UniProt ID Q86W42
Cytogenetics 16p13.3
Summary This gene encodes a subunit of the multi-protein THO complex, which is involved in coordination between transcription and mRNA processing. The THO complex is a component of the TREX (transcription/export) complex, which is involved in transcription and export of mRNAs. A missense mutation in this gene is associated with a neurodevelopmental disorder called Beaulieu-Boycott-Innes syndrome. [provided by RefSeq, Dec 2016]
Write Your Own Review
You're reviewing:WDR58 (THOC6) (NM_024339) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411297 THOC6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428050 THOC6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411297 Transient overexpression lysate of THO complex 6 homolog (Drosophila) (THOC6), transcript variant 1 100 ug
$436.00
LY428050 Transient overexpression lysate of THO complex 6 homolog (Drosophila) (THOC6), transcript variant 2 100 ug
$436.00
TP308694 Recombinant protein of human THO complex 6 homolog (Drosophila) (THOC6), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.