OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

POLR1H (NM_170783) Human Mass Spec Standard

Be the first to review this product
SKU
PH308651
ZNRD1 MS Standard C13 and N15-labeled recombinant protein (NP_740753)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA505067 ZNRD1 mouse monoclonal antibody, clone OTI1G2 (formerly 1G2) 100 ul
$447.00
LY415176 Transient overexpression lysate of zinc ribbon domain containing 1 (ZNRD1), transcript variant b (as WB positive control) 100 ug
$436.00

Other products for "POLR1H or NM_170783"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208651
Predicted MW 13.9 kDa
Protein Sequence
Protein Sequence
>RC208651 protein sequence
Red=Cloning site Green=Tags(s)

MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPM
SVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_740753
RefSeq Size 885
RefSeq ORF 378
Synonyms A12.2; HTEX-6; HTEX6; hZR14; Rpa12; tctex-6; TCTEX6; TEX6; ZNRD1; ZR14
Locus ID 30834
UniProt ID Q9P1U0
Cytogenetics 6p22.1
Summary This gene encodes a DNA-directed RNA polymerase I subunit. The encoded protein contains two potential zinc-binding motifs and may play a role in regulation of cell proliferation. The encoded protein may be involved in cancer and human immunodeficiency virus progression. Alternative splicing results in multiple transcript variants. provided by RefSeq, Jul 2013
Protein Families Transcription Factors
Protein Pathways Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "POLR1H" proteins (5)
SKU Description Size Price
LC406880 Lyophilized ZNRD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC415176 Lyophilized ZNRD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY406880 Transient overexpression lysate of zinc ribbon domain containing 1 (ZNRD1), transcript variant a (as WB positive control) 100 ug
$436.00
LY415176 Transient overexpression lysate of zinc ribbon domain containing 1 (ZNRD1), transcript variant b (as WB positive control) 100 ug
$436.00
TP308651 Recombinant protein of human zinc ribbon domain containing 1 (ZNRD1), transcript variant a, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products