CA13 (NM_198584) Human Mass Spec Standard

SKU
PH308607
CA13 MS Standard C13 and N15-labeled recombinant protein (NP_940986)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208607]
Predicted MW 29.4 kDa
Protein Sequence
Protein Sequence
>RC208607 protein sequence
Red=Cloning site Green=Tags(s)

MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVD
FDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPD
GLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTW
IVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_940986
RefSeq Size 3855
RefSeq ORF 786
Synonyms CAXIII
Locus ID 377677
UniProt ID Q8N1Q1
Cytogenetics 8q21.2
Summary Carbonic anhydrases (CAs) are a family of zinc metalloenzymes. For background information on the CA family, see MIM 114800.[supplied by OMIM, Mar 2008]
Protein Families Druggable Genome
Protein Pathways Nitrogen metabolism
Write Your Own Review
You're reviewing:CA13 (NM_198584) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC404835 CA13 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404835 Transient overexpression lysate of carbonic anhydrase XIII (CA13) 100 ug
$436.00
TP308607 Recombinant protein of human carbonic anhydrase XIII (CA13), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720089 Recombinant protein of human carbonic anhydrase XIII (CA13) 10 ug
$200.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.