PHKG1 (NM_006213) Human Mass Spec Standard

SKU
PH308591
PHKG1 MS Standard C13 and N15-labeled recombinant protein (NP_006204)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208591]
Predicted MW 45 kDa
Protein Sequence
Protein Sequence
>RC208591 protein sequence
Red=Cloning site Green=Tags(s)

MTRDEALPDSHSAQDFYENYEPKEILGRGVSSVVRRCIHKPTSQEYAVKVIDVTGGGSFSPEEVRELREA
TLKEVDILRKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLTEKVTLSEKETRKIMRALLEVICT
LHKLNIVHRDLKPENILLDDNMNIKLTDFGFSCQLEPGERLREVCGTPSYLAPEIIECSMNEDHPGYGKE
VDMWSTGVIMYTLLAGSPPFWHRKQMLMLRMIMSGNYQFGSPEWDDYSDTVKDLVSRFLVVQPQNRYTAE
EALAHPFFQQYLVEEVRHFSPRGKFKVIALTVLASVRIYYQYRRVKPVTREIVIRDPYALRPLRRLIDAY
AFRIYGHWVKKGQQQNRAALFENTPKAVLLSLAEEDY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006204
RefSeq Size 2130
RefSeq ORF 1161
Synonyms PHKG
Locus ID 5260
UniProt ID Q16816
Cytogenetics 7p11.2
Summary This gene is a member of the Ser/Thr protein kinase family and encodes a protein with one protein kinase domain and two calmodulin-binding domains. This protein is the catalytic member of a 16 subunit protein kinase complex which contains equimolar ratios of 4 subunit types. The complex is a crucial glycogenolytic regulatory enzyme. This gene has two pseudogenes at chromosome 7q11.21 and one at chromosome 11p11.12. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2012]
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Calcium signaling pathway, Insulin signaling pathway
Write Your Own Review
You're reviewing:PHKG1 (NM_006213) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401872 PHKG1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401872 Transient overexpression lysate of phosphorylase kinase, gamma 1 (muscle) (PHKG1) 100 ug
$436.00
TP308591 Recombinant protein of human phosphorylase kinase, gamma 1 (muscle) (PHKG1), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.