MLYCD (NM_012213) Human Mass Spec Standard

SKU
PH308587
MLYCD MS Standard C13 and N15-labeled recombinant protein (NP_036345)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208587]
Predicted MW 54.8 kDa
Protein Sequence
Protein Sequence
>RC208587 representing NM_012213
Red=Cloning site Green=Tags(s)

MRGFGPGLTARRLLPLRLPPRPPGPRLASGQAAGALERAMDELLRRAVPPTPAYELREKTPAPAEGQCAD
FVSFYGGLAETAQRAELLGRLARGFGVDHGQVAEQSAGVLHLRQQQREAAVLLQAEDRLRYALVPRYRGL
FHHISKLDGGVRFLVQLRADLLEAQALKLVEGPDVREMNGVLKGMLSEWFSSGFLNLERVTWHSPCEVLQ
KISEAEAVHPVKNWMDMKRRVGPYRRCYFFSHCSTPGEPLVVLHVALTGDISSNIQAIVKEHPPSETEEK
NKITAAIFYSISLTQQGLQGVELGTFLIKRVVKELQREFPHLGVFSSLSPIPGFTKWLLGLLNSQTKEHG
RNELFTDSECKEISEITGGPINETLKLLLSSSEWVQSEKLVRALQTPLMRLCAWYLYGEKHRGYALNPVA
NFHLQNGAVLWRINWMADVSLRGITGSCGLMANYRYFLEETGPNSTSYLGSKIIKASEQVLSLVAQFQKN
SKL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036345
RefSeq Size 2211
RefSeq ORF 1479
Synonyms MCD
Locus ID 23417
UniProt ID O95822
Cytogenetics 16q23.3
Summary The product of this gene catalyzes the breakdown of malonyl-CoA to acetyl-CoA and carbon dioxide. Malonyl-CoA is an intermediate in fatty acid biosynthesis, and also inhibits the transport of fatty acyl CoAs into mitochondria. Consequently, the encoded protein acts to increase the rate of fatty acid oxidation. It is found in mitochondria, peroxisomes, and the cytoplasm. Mutations in this gene result in malonyl-CoA decarboyxlase deficiency. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways beta-Alanine metabolism, Metabolic pathways, Propanoate metabolism
Write Your Own Review
You're reviewing:MLYCD (NM_012213) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC415904 MLYCD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415904 Transient overexpression lysate of malonyl-CoA decarboxylase (MLYCD), nuclear gene encoding mitochondrial protein 100 ug
$436.00
TP308587 Recombinant protein of human malonyl-CoA decarboxylase (MLYCD), nuclear gene encoding mitochondrial protein, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.