FTCD (NM_006657) Human Mass Spec Standard

SKU
PH308573
FTCD MS Standard C13 and N15-labeled recombinant protein (NP_006648)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208573]
Predicted MW 58.9 kDa
Protein Sequence
Protein Sequence
>RC208573 protein sequence
Red=Cloning site Green=Tags(s)

MSQLVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVAS
RLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELDVPVYLYGEAARMDSRRTLPA
IRAGEYEALPKKLQQADWAPDFGPSSFVPSWGATATGARKFLIAFNINLLGTKEQAHRIALNLREQGRGK
DQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLD
AAAFYCEKENLFILEEEQRIRLVVSRLGLDSLCPFSPKERIIEYLVPERGPERGLGSKSLRAFVGEVGAR
SAAPGGGSVAAAAAAMGAALGSMVGLMTYGRRQFQSLDTTMRRLIPPFREASAKLTTLVDADAEAFTAYL
EAMRLPKNTPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMG
VFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006648
RefSeq Size 1921
RefSeq ORF 1623
Synonyms LCHC1
Locus ID 10841
UniProt ID O95954
Cytogenetics 21q22.3
Summary The protein encoded by this gene is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool. Mutations in this gene are associated with glutamate formiminotransferase deficiency. Alternatively spliced transcript variants have been found for this gene.[provided by RefSeq, Dec 2009]
Protein Pathways Histidine metabolism, Metabolic pathways, One carbon pool by folate
Write Your Own Review
You're reviewing:FTCD (NM_006657) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC404121 FTCD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC416500 FTCD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404121 Transient overexpression lysate of formiminotransferase cyclodeaminase (FTCD), transcript variant A 100 ug
$665.00
LY416500 Transient overexpression lysate of formiminotransferase cyclodeaminase (FTCD), transcript variant B 100 ug
$436.00
TP308573 Recombinant protein of human formiminotransferase cyclodeaminase (FTCD), transcript variant B, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.