FAM83A (NM_032899) Human Mass Spec Standard

SKU
PH308565
FAM83A MS Standard C13 and N15-labeled recombinant protein (NP_116288)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208565]
Predicted MW 47.5 kDa
Protein Sequence
Protein Sequence
>RC208565 protein sequence
Red=Cloning site Green=Tags(s)

MSRSRHLGKIRKRLEDVKSQWVRPARADFSDNESARLATDALLDGGSEAYWRVLSQEGEVDFLSSVEAQY
IQAQAREPPCPPDTLGGAEAGPKGLDSSSLQSGTYFPVASEGSEPALLHSWASAEKPYLKEKSSATVYFQ
TVKHNNIRDLVRRCITRTSQVLVILMDVFTDVEIFCDILEAANKRGVFVCVLLDQGGVKLFQEMCDKVQI
SDSHLKNISIRSVEGEIYCAKSGRKFAGQIREKFIISDWRFVLSGSYSFTWLCGHVHRNILSKFTGQAVE
LFDEEFRHLYASSKPVMGLKSPRLVAPVPPGAAPANGRLSSSSGSASDRTSSNPFSGRSAGSHPGTRSVS
ASSGPCSPAAPHPPPPPRFQPHQGPWGAPSPQAHLSPRPHDGPPAAVYSNLGAYRPTRLQLEQLGLVPRL
TPTWRPFLQASPHF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_116288
RefSeq Size 4596
RefSeq ORF 1302
Synonyms BJ-TSA-9
Locus ID 84985
UniProt ID Q86UY5
Cytogenetics 8q24.13
Summary Probable proto-oncogene that functions in the epidermal growth factor receptor/EGFR signaling pathway. Activates both RAS/MAPK and PI3K/AKT/TOR signaling cascades downstream of EGFR. Required for the RAS/MAPK signaling cascade activation upon EGFR stimulation, it also activates both signaling cascades independently of EGFR activation.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:FAM83A (NM_032899) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC404130 FAM83A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC409861 FAM83A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404130 Transient overexpression lysate of family with sequence similarity 83, member A (FAM83A), transcript variant 2 100 ug
$436.00
LY409861 Transient overexpression lysate of family with sequence similarity 83, member A (FAM83A), transcript variant 1 100 ug
$436.00
TP308565 Recombinant protein of human family with sequence similarity 83, member A (FAM83A), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.