LEMD2 (NM_181336) Human Mass Spec Standard

SKU
PH308535
LEMD2 MS Standard C13 and N15-labeled recombinant protein (NP_851853)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208535]
Predicted MW 57 kDa
Protein Sequence
Protein Sequence
>RC208535 protein sequence
Red=Cloning site Green=Tags(s)

MAGLSDLELRRELQALGFQPGPITDTTRDVYRNKLRRLRGEARLRDEERLREEARPRGEERLREEARLRE
DAPLRARPAAASPRAEPWLSQPASGSAYATPGAYGDIRPSAASWVGSRGLAYPARPAQLRRRASVRGSSE
EDEDARTPDRATQGPGLAARRWWAASPAPARLPSSLLGPDPRPGLRATRAGPAGAARARPEVGRRLERWL
SRLLLWASLGLLLVFLGILWVKMGKPSAPQEAEDNMKLLPVDCERKTDEFCQAKQKAALLELLHELYNFL
AIQAGNFECGNPENLKSKCIPVMEAQEYIANVTSSSSAKFEAALTWILSSNKDVGIWLKGEDQSELVTTV
DKVVCLESAHPRMGVGCRLSRALLTAVTNVLIFFWCLAFLWGLLILLKYRWRKLEEEEQAMYEMVKKIID
VVQDHYVDWEQDMERYPYVGILHVRDSLIPPQSRRRMKRVWDRAVEFLASNESRIQTESHRVAGEDMLVW
RWTKPSSFSDSER

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_851853
RefSeq Size 2957
RefSeq ORF 1509
Synonyms CTRCT42; dJ482C21.1; LEM2; MARUPS; NET25
Locus ID 221496
UniProt ID Q8NC56
Cytogenetics 6p21.31
Summary This gene encodes a LEM domain-containing transmembrane protein of the inner nuclear membrane. The protein is involved in nuclear structure organization and plays a role in cell signaling and differentiation. Mutations in this gene result in Cataract 46, juvenile-onset. Multiple transcript variants have been found for this gene. [provided by RefSeq, Feb 2017]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:LEMD2 (NM_181336) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC405791 LEMD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405791 Transient overexpression lysate of LEM domain containing 2 (LEMD2), transcript variant 1 100 ug
$436.00
TP308535 Recombinant protein of human LEM domain containing 2 (LEMD2), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.