Mitocondrial Translational Initiation Factor 3 (MTIF3) (NM_152912) Human Mass Spec Standard

SKU
PH308533
MTIF3 MS Standard C13 and N15-labeled recombinant protein (NP_690876)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208533]
Predicted MW 31.7 kDa
Protein Sequence
Protein Sequence
>RC208533 protein sequence
Red=Cloning site Green=Tags(s)

MAALFLKRLTLQTVKSENSCIRCFGKHILQKTAPAQLSPIASAPRLSFLIHAKAFSTAEDTQNEGKKIKK
NKTAFSNVGRKISQRVIHLFDEKGNDLGNMHRANVIRLMDERDLRLVQRNTSTEPAEYQLMTGLQILQER
QRLREMEKANPKTGPTLRKELILSSNIGQHDLDTKTKQIQQWIKKKHLVQITIKKGKNVDVSENEMEEIF
HQILQTMPGIATFSSRPQAVQGGKALMCVLRALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_690876
RefSeq Size 1037
RefSeq ORF 834
Synonyms IF3mt
Locus ID 219402
UniProt ID Q9H2K0
Cytogenetics 13q12.2
Summary This gene encodes a translation initiation factor that is involved in mitochondrial protein synthesis. Polymorphism in this gene is associated with the onset of Parkinson's disease. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 5. [provided by RefSeq, Oct 2009]
Write Your Own Review
You're reviewing:Mitocondrial Translational Initiation Factor 3 (MTIF3) (NM_152912) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC407210 MTIF3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432812 MTIF3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY407210 Transient overexpression lysate of mitochondrial translational initiation factor 3 (MTIF3), nuclear gene encoding mitochondrial protein, transcript variant 2 100 ug
$436.00
LY432812 Transient overexpression lysate of mitochondrial translational initiation factor 3 (MTIF3), nuclear gene encoding mitochondrial protein, transcript variant 4 100 ug
$436.00
TP308533 Recombinant protein of human mitochondrial translational initiation factor 3 (MTIF3), nuclear gene encoding mitochondrial protein, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.