PLAC1L (OOSP2) (NM_173801) Human Mass Spec Standard

SKU
PH308472
PLAC1L MS Standard C13 and N15-labeled recombinant protein (NP_776162)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208472]
Predicted MW 18 kDa
Protein Sequence
Protein Sequence
>RC208472 protein sequence
Red=Cloning site Green=Tags(s)

MALEVLMLLAVLIWTGAENLHVKISCSLDWLMVSVIPVAESRNLYIFADELHLGMGCPANRIHTYVYEFI
YLVRDCGIRTRVVSEETLLFQTELYFTPRNIDHDPQEIHLECSTSRKSVWLTPVSTENEIKLDPSPFIAD
FQTTAEELGLLSSSPNLL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_776162
RefSeq Size 1646
RefSeq ORF 474
Synonyms OOSP2A; PLAC1L; TMEM122
Locus ID 219990
UniProt ID Q86WS3
Cytogenetics 11q12.1
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:PLAC1L (OOSP2) (NM_173801) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403561 OOSP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403561 Transient overexpression lysate of placenta-specific 1-like (PLAC1L) 100 ug
$436.00
TP308472 Recombinant protein of human placenta-specific 1-like (PLAC1L), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.