CELF3 (NM_007185) Human Mass Spec Standard

SKU
PH308465
CELF3 MS Standard C13 and N15-labeled recombinant protein (NP_009116)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208465]
Predicted MW 50.5 kDa
Protein Sequence
Protein Sequence
>RC208465 protein sequence
Red=Cloning site Green=Tags(s)

MKEPDAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHE
QKTLPGMNRPIQVKPADSESRGEDRKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFV
KFQTHAEAKAAINTLHSSRTLPGASSSLVVKFADTEKERGLRRMQQVATQLGMFSPITLQFGAYSAYTQA
LMQQQAALVAAHSAYLSPMATMAAVQMQHMAAINANGLIATPITPSSGTSTPPAIAATPVSAIPAALGVN
GYSQVPTQPTGQPAPDALYPNGVHPYPAQSPAAPVDPLQQAYAGMQHYTAYPAAYSLVAPAFPQPPALVA
QQPPPPPQQQQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMFVPFGHVISAKVFVDRATNQSK
CFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDANRPY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_009116
RefSeq Size 5615
RefSeq ORF 1392
Synonyms BRUNOL1; CAGH4; ERDA4; ETR-1; TNRC4
Locus ID 11189
UniProt ID Q5SZQ8
Cytogenetics 1q21.3
Summary Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Multiple alternatively spliced transcript variants encoding different isoforms have been identified in this gene. [provided by RefSeq, Feb 2010]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:CELF3 (NM_007185) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416136 CELF3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC433039 CELF3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416136 Transient overexpression lysate of trinucleotide repeat containing 4 (TNRC4) 100 ug
$436.00
LY433039 Transient overexpression lysate of CUGBP, Elav-like family member 3 (CELF3), transcript variant 3 100 ug
$436.00
TP308465 Recombinant protein of human trinucleotide repeat containing 4 (TNRC4), 20 µg 20 ug
$737.00
TP330039 Purified recombinant protein of Homo sapiens CUGBP, Elav-like family member 3 (CELF3), transcript variant 3, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.