TSEN54 (NM_207346) Human Mass Spec Standard

SKU
PH308425
TSEN54 MS Standard C13 and N15-labeled recombinant protein (NP_997229)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208425]
Predicted MW 58.6 kDa
Protein Sequence
Protein Sequence
>RC208425 representing NM_207346
Red=Cloning site Green=Tags(s)

MEPEPEPAAVEVPAGRVLSARELFAARSRSQKLPQRSHGPKDFLPDGSAAQAERLRRCREELWQLLAEQR
VERLGSLVAAEWRPEEGFVELKSPAGKFWQTMGFSEQGRQRLHPEEALYLLECGSIHLFHQDLPLSIQEA
YQLLLTDHTVTFLQYQVFSHLKKLGYVVRRFQPSSVLSPYERQLNLDASVQHLEDGDGKRKRSSSSPRSI
NKKAKALDNSLQPKSLAASSPPPCSQPSQCPEEKPQESSPMKGPGGPFQLLGSLGPSPGPAREGVGCSWE
SGRAENGVTGAGKRRWNFEQISFPNMASDSRHTLLRAPAPELLPANVAGRETDAESWCQKLNQRKENLSR
REREHHAEAAQFQEDVNADPEVQRCSSWREYKELLQRRQVQRSQRRAPHLWGQPVTPLLSPGQASSPAVV
LQHISVLQTTHLPDGGVRLLEKSGGLEIIFDVYQADAVATFRKNNPGKPYARMCISGFDEPVPDLCSLKR
LSYQSGDVPLIFALVDHGDISFYSFRDFTLPQDVGH

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_997229
RefSeq Size 1970
RefSeq ORF 1578
Synonyms PCH2A; PCH4; PCH5; sen54; SEN54L
Locus ID 283989
UniProt ID Q7Z6J9
Cytogenetics 17q25.1
Summary This gene encodes a subunit of the tRNA splicing endonuclease complex, which catalyzes the removal of introns from precursor tRNAs. The complex is also implicated in pre-mRNA 3-prime end processing. Mutations in this gene result in pontocerebellar hypoplasia type 2.[provided by RefSeq, Oct 2009]
Write Your Own Review
You're reviewing:TSEN54 (NM_207346) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403972 TSEN54 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403972 Transient overexpression lysate of tRNA splicing endonuclease 54 homolog (S. cerevisiae) (TSEN54) 100 ug
$436.00
TP308425 Recombinant protein of human tRNA splicing endonuclease 54 homolog (S. cerevisiae) (TSEN54), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.