APOBEC2 (NM_006789) Human Mass Spec Standard

SKU
PH308399
APOBEC2 MS Standard C13 and N15-labeled recombinant protein (NP_006780)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208399]
Predicted MW 25.5 kDa
Protein Sequence
Protein Sequence
>RC208399 representing NM_006789
Red=Cloning site Green=Tags(s)

MAQKEEAAVATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRNVEYSSGRNKTFL
CYVVEAQGKGGQVQASRGYLEDEHAAAHAEEAFFNTILPAFDPALRYNVTWYVSSSPCAACADRIIKTLS
KTKNLRLLILVGRLFMWEEPEIQAALKKLKEAGCKLRIMKPQDFEYVWQNFVEQEEGESKAFQPWEDIQE
NFLYYEEKLADILK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006780
RefSeq Size 1195
RefSeq ORF 672
Synonyms ARCD1; ARP1
Locus ID 10930
UniProt ID Q9Y235
Cytogenetics 6p21.1
Summary Probable C to U editing enzyme whose physiological substrate is not yet known. Does not display detectable apoB mRNA editing. Has a low intrinsic cytidine deaminase activity. May play a role in the epigenetic regulation of gene expression through the process of active DNA demethylation.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:APOBEC2 (NM_006789) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416413 APOBEC2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416413 Transient overexpression lysate of apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2 (APOBEC2) 100 ug
$436.00
TP308399 Recombinant protein of human apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2 (APOBEC2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.