GLYCTK (NM_145262) Human Mass Spec Standard

SKU
PH308348
GLYCTK MS Standard C13 and N15-labeled recombinant protein (NP_660305)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208348]
Predicted MW 55.3 kDa
Protein Sequence
Protein Sequence
>RC208348 protein sequence
Red=Cloning site Green=Tags(s)

MAAALQVLPRLARAPLHPLLWRGSVARLASSMALAEQARQLFESAVGAVLPGPMLHRALSLDPGGRQLKV
RDRNFQLRQNLYLVGFGKAVLGMAAAAEELLGQHLVQGVISVPKGIRAAMERAGKQEMLLKPHSRVQVFE
GAEDNLPDRDALRAALAIQQLAEGLTADDLLLVLISGGGSALLPAPIPPVTLEEKQTLTRLLAARGATIQ
ELNTIRKALSQLKGGGLAQAAYPAQVVSLILSDVVGDPVEVIASGPTVASSHNVQDCLHILNRYGLRAAL
PRSVKTVLSRADSDPHGPHTCGHVLNVIIGSNVLALAEAQRQAEALGYQAVVLSAAMQGDVKSMAQFYGL
LAHVARTRLTPSMAGASVEEDAQLHELAAELQIPDLQLEEALETMAWGRGPVCLLAGGEPTVQLQGSGRG
GRNQELALRVGAELRRWPLGPIDVLFLSGGTDGQDGPTEAAGAWVTPELASQAAAEGLDIATFLAHNDSH
TFFCCLQGGAHLLHTGMTGTNVMDTHLLFLRPR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_660305
RefSeq Size 3798
RefSeq ORF 1569
Synonyms HBeAgBP4A; HBEBP2; HBEBP4
Locus ID 132158
UniProt ID Q8IVS8
Cytogenetics 3p21.2
Summary This locus encodes a member of the glycerate kinase type-2 family. The encoded enzyme catalyzes the phosphorylation of (R)-glycerate and may be involved in serine degradation and fructose metabolism. Decreased activity of the encoded enzyme may be associated with the disease D-glyceric aciduria. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jan 2009]
Protein Families Transcription Factors
Protein Pathways Glycerolipid metabolism, Glycine, Glyoxylate and dicarboxylate metabolism, Metabolic pathways, serine and threonine metabolism
Write Your Own Review
You're reviewing:GLYCTK (NM_145262) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC407988 GLYCTK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY407988 Transient overexpression lysate of glycerate kinase (GLYCTK), transcript variant 1 100 ug
$436.00
TP308348 Recombinant protein of human glycerate kinase (GLYCTK), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.