OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GLYCTK (NM_145262) Human Mass Spec Standard

Be the first to review this product
SKU
PH308348
GLYCTK MS Standard C13 and N15-labeled recombinant protein (NP_660305)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA316105 Rabbit polyclonal anti-GLCTK antibody
100 ul
$380.00
LY407988 Transient overexpression lysate of glycerate kinase (GLYCTK), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "GLYCTK or NM_145262"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208348
Predicted MW 55.3 kDa
Protein Sequence
Protein Sequence
>RC208348 protein sequence
Red=Cloning site Green=Tags(s)

MAAALQVLPRLARAPLHPLLWRGSVARLASSMALAEQARQLFESAVGAVLPGPMLHRALSLDPGGRQLKV
RDRNFQLRQNLYLVGFGKAVLGMAAAAEELLGQHLVQGVISVPKGIRAAMERAGKQEMLLKPHSRVQVFE
GAEDNLPDRDALRAALAIQQLAEGLTADDLLLVLISGGGSALLPAPIPPVTLEEKQTLTRLLAARGATIQ
ELNTIRKALSQLKGGGLAQAAYPAQVVSLILSDVVGDPVEVIASGPTVASSHNVQDCLHILNRYGLRAAL
PRSVKTVLSRADSDPHGPHTCGHVLNVIIGSNVLALAEAQRQAEALGYQAVVLSAAMQGDVKSMAQFYGL
LAHVARTRLTPSMAGASVEEDAQLHELAAELQIPDLQLEEALETMAWGRGPVCLLAGGEPTVQLQGSGRG
GRNQELALRVGAELRRWPLGPIDVLFLSGGTDGQDGPTEAAGAWVTPELASQAAAEGLDIATFLAHNDSH
TFFCCLQGGAHLLHTGMTGTNVMDTHLLFLRPR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_660305
RefSeq Size 3798
RefSeq ORF 1569
Synonyms HBeAgBP4A; HBEBP2; HBEBP4
Locus ID 132158
UniProt ID Q8IVS8
Cytogenetics 3p21.2
Summary This locus encodes a member of the glycerate kinase type-2 family. The encoded enzyme catalyzes the phosphorylation of (R)-glycerate and may be involved in serine degradation and fructose metabolism. Decreased activity of the encoded enzyme may be associated with the disease D-glyceric aciduria. Alternatively spliced transcript variants have been described. provided by RefSeq, Jan 2009
Protein Families Transcription Factors
Protein Pathways Glycerolipid metabolism, Glycine, Glyoxylate and dicarboxylate metabolism, Metabolic pathways, serine and threonine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GLYCTK" proteins (3)
SKU Description Size Price
LC407988 Lyophilized GLYCTK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407988 Transient overexpression lysate of glycerate kinase (GLYCTK), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP308348 Recombinant protein of human glycerate kinase (GLYCTK), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products