Peptide YY (PYY) (NM_004160) Human Mass Spec Standard

SKU PH308334

PYY MS Standard C13 and N15-labeled recombinant protein (NP_004151)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC208334]
• Predicted MW: 11.1 kDa
• Protein Sequence:
  Protein Sequence

  >RC208334 protein sequence; Red=Cloning site Green=Tags(s); ; MVFVRRPWPALTTVLLALLVCLGALVDAYPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRYGKRDGP; DRLLSKTFFPDGEDRPVRSRSEGPDLW; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_004151
• RefSeq Size: 1069
• RefSeq ORF: 291
• Synonyms: PYY-I; PYY1
• Locus ID: 5697
• UniProt ID: P10082
• Cytogenetics: 17q21.31
• Summary: This gene encodes a member of the neuropeptide Y (NPY) family of peptides. The encoded preproprotein is proteolytically processed to generate two alternative peptide products that differ in length by three amino acids. These peptides, secreted by endocrine cells in the gut, exhibit different binding affinities for each of the neuropeptide Y receptors. Binding of the encoded peptides to these receptors mediates regulation of pancreatic secretion, gut mobility and energy homeostasis. Rare variations in this gene could increase susceptibility to obesity and elevated serum levels of the encoded peptides may be associated with anorexia nervosa. [provided by RefSeq, Feb 2016]
• Protein Families: Secreted Protein, Transmembrane