GGA1 (NM_001001560) Human Mass Spec Standard

SKU
PH308305
GGA1 MS Standard C13 and N15-labeled recombinant protein (NP_001001560)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208305]
Predicted MW 61.4 kDa
Protein Sequence
Protein Sequence
>RC208305 protein sequence
Red=Cloning site Green=Tags(s)

MEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQSPQEWEAIQALTVL
ETCMKSCGKRFHDEVGKFRFLNELIKVVSPKYLGSRTSEKVKNKILELLYSWTVGLPEEVKIAEAYQMLK
KQGIVKSDPKLPDDTTFPLPPPRPKNVIFEDEEKSKMLARLLKSSHPEDLRAANKLIKEMVQEDQKRMEK
ISKRVNAIEEVNNNVKLLTEMVMSHSQGGAAAGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALGLS
DPTPPSGPSLDGTGWNSFQSSDATEPPAPALAQAPSMESRPPAQTSLPASSGLDDLDLLGKTLLQQSLPP
ESQQVRWEKQQPTPRLTLRDLQNKSSSCSSPSSSATSLLHTVSPEPPRPPQQPVPTELSLASITVPLESI
KPSNILPVTVYDQHGFRILFHFARDPLPGRSDVLVVVVSMLSTAPQPIRNIVFQSAVPKVMKVKLQPPSG
TELPAFNPIVHPSAITQVLLLANPQKEKVRLRYKLTFTMGDQTYNEMGDVDQFPPPETWGSL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001001560
RefSeq Size 2924
RefSeq ORF 1656
Locus ID 26088
UniProt ID Q9UJY5
Cytogenetics 22q13.1
Summary This gene encodes a member of the Golgi-localized, gamma adaptin ear-containing, ARF-binding (GGA) protein family. Members of this family are ubiquitous coat proteins that regulate the trafficking of proteins between the trans-Golgi network and the lysosome. These proteins share an amino-terminal VHS domain which mediates sorting of the mannose 6-phosphate receptors at the trans-Golgi network. They also contain a carboxy-terminal region with homology to the ear domain of gamma-adaptins. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Lysosome
Write Your Own Review
You're reviewing:GGA1 (NM_001001560) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC415668 GGA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424381 GGA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC433284 GGA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC433376 GGA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415668 Transient overexpression lysate of golgi associated, gamma adaptin ear containing, ARF binding protein 1 (GGA1), transcript variant 1 100 ug
$665.00
LY424381 Transient overexpression lysate of golgi associated, gamma adaptin ear containing, ARF binding protein 1 (GGA1), transcript variant 2 100 ug
$436.00
LY433284 Transient overexpression lysate of golgi-associated, gamma adaptin ear containing, ARF binding protein 1 (GGA1), transcript variant 5 100 ug
$436.00
LY433376 Transient overexpression lysate of golgi-associated, gamma adaptin ear containing, ARF binding protein 1 (GGA1), transcript variant 4 100 ug
$436.00
TP308305 Recombinant protein of human golgi associated, gamma adaptin ear containing, ARF binding protein 1 (GGA1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.