beta Defensin 1 (DEFB1) (NM_005218) Human Mass Spec Standard

SKU PH308244

DEFB1 MS Standard C13 and N15-labeled recombinant protein (NP_005209)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC208244]
• Predicted MW: 7.4 kDa
• Protein Sequence:
  Protein Sequence

  >RC208244 protein sequence; Red=Cloning site Green=Tags(s); ; MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_005209
• RefSeq Size: 484
• RefSeq ORF: 204
• Synonyms: BD1; DEFB-1; DEFB101; HBD1
• Locus ID: 1672
• UniProt ID: P60022
• Cytogenetics: 8p23.1
• Summary: Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 1, an antimicrobial peptide implicated in the resistance of epithelial surfaces to microbial colonization. This gene maps in close proximity to defensin family member, defensin, alpha 1 and has been implicated in the pathogenesis of cystic fibrosis. [provided by RefSeq, Jul 2008]
• Protein Families: Secreted Protein