Neuronal calcium binding protein (NECAB3) (NM_031231) Human Mass Spec Standard

SKU
PH308242
NECAB3 MS Standard C13 and N15-labeled recombinant protein (NP_112508)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208242]
Predicted MW 40.8 kDa
Protein Sequence
Protein Sequence
>RC208242 protein sequence
Red=Cloning site Green=Tags(s)

MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADKNDDGKLSFEEFQNYFADGVL
SLGELQELFSGIDGHLTDNLETEKLCDYFSEHLGVYRPVLAALESLNRAVLAAMDATKLEYERASKVDQF
VTRFLLRETVSQLQALQSSLEGASDTLEAQAHGWRSDAESVEAQSRLCGSRRAGRRALRSVSRSSTWSPG
SSDTGRSSEAEMQWRLQVNRLQELIDQLECKAPRLEPLREEDLAKGPDLHILMAQRQVQVAEEGLQDFHR
ALRCYVDFTGAQSHCLHVSAQKMLDGASFTLYEFWQDEASWRRHQQSPGSKAFQRILIDHLRAPDTLTTV
FFPASWWIMNNN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_112508
RefSeq Size 1961
RefSeq ORF 1086
Synonyms APBA2BP; dJ63M2.4; dJ63M2.5; EFCBP3; NIP1; STIP3; SYTIP2; XB51
Locus ID 63941
UniProt ID Q96P71
Cytogenetics 20q11.22
Summary The protein encoded by this gene interacts with the amino-terminal domain of the neuron-specific X11-like protein (X11L), inhibits the association of X11L with amyloid precursor protein through a non-competitive mechanism, and abolishes the suppression of beta-amyloid production by X11L. This protein, together with X11L, may play an important role in the regulatory system of amyloid precursor protein metabolism and beta-amyloid generation. The protein is phosphorylated by NIMA-related expressed kinase 2, and localizes to the Golgi apparatus. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Neuronal calcium binding protein (NECAB3) (NM_031231) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC410597 NECAB3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC410598 NECAB3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410597 Transient overexpression lysate of N-terminal EF-hand calcium binding protein 3 (NECAB3), transcript variant 1 100 ug
$436.00
LY410598 Transient overexpression lysate of N-terminal EF-hand calcium binding protein 3 (NECAB3), transcript variant 2 100 ug
$436.00
TP308242 Recombinant protein of human N-terminal EF-hand calcium binding protein 3 (NECAB3), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.