ETFBKMT (NM_173802) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC208154] |
Predicted MW | 29.5 kDa |
Protein Sequence |
Protein Sequence
>RC208154 protein sequence
Red=Cloning site Green=Tags(s) MALSLGWKAHRNHCGLLLQALRSSGLLLFPCGQCPWRGAGSFLDPEIKAFLEENTEVTSSGSLTPEIQLR LLTPRCKFWWERADLWPHSDPYWAIYWPGGQALSRYLLDNPDVVRGKSVLDLGSGCGATAIAAKMSGASR ILANDIDPIAGMAITLNCELNRLNPFPILIQNILNLEQDKWDLVVLGDMFYDEDLADSLHQWLKKCFWTY RTRVLIGDPGRPQFSGHSIQHHLHKVVEYSLLESTRQENSGLTTSTVWGFQP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_776163 |
RefSeq Size | 2183 |
RefSeq ORF | 786 |
Synonyms | C12orf72; ETFB-KMT; METTL20 |
Locus ID | 254013 |
UniProt ID | Q8IXQ9 |
Cytogenetics | 12p11.21 |
Summary | Protein-lysine methyltransferase that selectively trimethylates the flavoprotein ETFB in mitochondria (PubMed:25023281, PubMed:25416781). Thereby, may negatively regulate the function of ETFB in electron transfer from Acyl-CoA dehydrogenases to the main respiratory chain (PubMed:25416781).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC406414 | METTL20 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC427724 | METTL20 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC427725 | METTL20 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY406414 | Transient overexpression lysate of chromosome 12 open reading frame 72 (C12orf72), transcript variant 1 | 100 ug |
$436.00
|
|
LY427724 | Transient overexpression lysate of chromosome 12 open reading frame 72 (C12orf72), transcript variant 2 | 100 ug |
$436.00
|
|
LY427725 | Transient overexpression lysate of chromosome 12 open reading frame 72 (C12orf72), transcript variant 3 | 100 ug |
$436.00
|
|
TP308154 | Recombinant protein of human chromosome 12 open reading frame 72 (C12orf72), transcript variant 1, 20 µg | 20 ug |
$867.00
|
|
TP760722 | Purified recombinant protein of Human methyltransferase like 20 (METTL20), transcript variant 3, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug | 50 ug |
$261.00
|
|
TP761472 | Purified recombinant protein of Human methyltransferase like 20 (METTL20), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.coli, 50ug | 50 ug |
$261.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.