ETFBKMT (NM_173802) Human Mass Spec Standard

SKU
PH308154
C12orf72 MS Standard C13 and N15-labeled recombinant protein (NP_776163)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208154]
Predicted MW 29.5 kDa
Protein Sequence
Protein Sequence
>RC208154 protein sequence
Red=Cloning site Green=Tags(s)

MALSLGWKAHRNHCGLLLQALRSSGLLLFPCGQCPWRGAGSFLDPEIKAFLEENTEVTSSGSLTPEIQLR
LLTPRCKFWWERADLWPHSDPYWAIYWPGGQALSRYLLDNPDVVRGKSVLDLGSGCGATAIAAKMSGASR
ILANDIDPIAGMAITLNCELNRLNPFPILIQNILNLEQDKWDLVVLGDMFYDEDLADSLHQWLKKCFWTY
RTRVLIGDPGRPQFSGHSIQHHLHKVVEYSLLESTRQENSGLTTSTVWGFQP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_776163
RefSeq Size 2183
RefSeq ORF 786
Synonyms C12orf72; ETFB-KMT; METTL20
Locus ID 254013
UniProt ID Q8IXQ9
Cytogenetics 12p11.21
Summary Protein-lysine methyltransferase that selectively trimethylates the flavoprotein ETFB in mitochondria (PubMed:25023281, PubMed:25416781). Thereby, may negatively regulate the function of ETFB in electron transfer from Acyl-CoA dehydrogenases to the main respiratory chain (PubMed:25416781).[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:ETFBKMT (NM_173802) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC406414 METTL20 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427724 METTL20 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427725 METTL20 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406414 Transient overexpression lysate of chromosome 12 open reading frame 72 (C12orf72), transcript variant 1 100 ug
$436.00
LY427724 Transient overexpression lysate of chromosome 12 open reading frame 72 (C12orf72), transcript variant 2 100 ug
$436.00
LY427725 Transient overexpression lysate of chromosome 12 open reading frame 72 (C12orf72), transcript variant 3 100 ug
$436.00
TP308154 Recombinant protein of human chromosome 12 open reading frame 72 (C12orf72), transcript variant 1, 20 µg 20 ug
$867.00
TP760722 Purified recombinant protein of Human methyltransferase like 20 (METTL20), transcript variant 3, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$261.00
TP761472 Purified recombinant protein of Human methyltransferase like 20 (METTL20), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.