DNAJC3 (NM_006260) Human Mass Spec Standard

SKU
PH308126
DNAJC3 MS Standard C13 and N15-labeled recombinant protein (NP_006251)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208126]
Predicted MW 57.6 kDa
Protein Sequence
Protein Sequence
>RC208126 protein sequence
Red=Cloning site Green=Tags(s)

MVAPGSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDN
YIAYYRRATVFLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSENE
EKEAQSQLIKSDEMQRLRSQALNAFGSGDYTAAIAFLDKILEVCVWDAELRELRAECFIKEGEPRKAISD
LKAASKLKNDNTEAFYKISTLYYQLGDHELSLSEVRECLKLDQDHKRCFAHYKQVKKLNKLIESAEELIR
DGRYTDATSKYESVMKTEPSIAEYTVRSKERICHCFSKDEKPVEAIRVCSEVLQMEPDNVNALKDRAEAY
LIEEMYDEAIQDYETAQEHNENDQQIREGLEKAQRLLKQSQKRDYYKILGVKRNAKKQEIIKAYRKLALQ
WHPDNFQNEEEKKKAEKKFIDIAAAKEVLSDPEMRKKFDDGEDPLDAESQQGGGGNPFHRSWNSWQGFNP
FSSGGPFRFKFHFN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006251
RefSeq Size 5598
RefSeq ORF 1512
Synonyms ACPHD; ERdj6; HP58; P58; p58(IPK); P58IPK; PRKRI
Locus ID 5611
UniProt ID Q13217
Cytogenetics 13q32.1
Summary This gene encodes a protein with multiple tetratricopeptide repeat (TPR) motifs as well as the highly conserved J domain found in DNAJ chaperone family members. It is a member of the tetratricopeptide repeat family of proteins and acts as an inhibitor of the interferon-induced, dsRNA-activated protein kinase (PKR). [provided by RefSeq, Jul 2010]
Write Your Own Review
You're reviewing:DNAJC3 (NM_006260) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416762 DNAJC3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416762 Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 3 (DNAJC3) 100 ug
$436.00
TP308126 Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 3 (DNAJC3), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.