DMRT1 (NM_021951) Human Mass Spec Standard

SKU
PH308108
DMRT1 MS Standard C13 and N15-labeled recombinant protein (NP_068770)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208108]
Predicted MW 39.5 kDa
Protein Sequence
Protein Sequence
>RC208108 protein sequence
Red=Cloning site Green=Tags(s)

MPNDEAFSKPSTPSEAPHAPGVPPQGRAGGFGKASGALVGAASGSSAGGSSRGGGSGSGASDLGAGSKKS
PRLPKCARCRNHGYASPLKGHKRFCMWRDCQCKKCNLIAERQRVMAAQVALRRQQAQEEELGISHPIPLP
SAAELLVKRENNGSNPCLMTECSGTSQPPPASVPTTAASEGRMVIQDIPAVTSRGHVENTPDLVSDSTYY
SSFYQPSLFPYYNNLYNCPQYSMALAADSASGEVGNPLGGSPVKNSLRGLPGPYVPGQTGNQWQMKNMEN
RHAMSSQYRMHSYYPPPSYLGQSVPQFFTFEDAPSYPEARASVFSPPSSQDSGLVSLSSSSPISNKSTKA
VLECEPASEPSSFTVTPVIEEDE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_068770
RefSeq Size 2229
RefSeq ORF 1119
Synonyms CT154; DMT1
Locus ID 1761
UniProt ID Q9Y5R6
Cytogenetics 9p24.3
Summary This gene is found in a cluster with two other members of the gene family, having in common a zinc finger-like DNA-binding motif (DM domain). The DM domain is an ancient, conserved component of the vertebrate sex-determining pathway that is also a key regulator of male development in flies and nematodes. This gene exhibits a gonad-specific and sexually dimorphic expression pattern. Defective testicular development and XY feminization occur when this gene is hemizygous. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:DMRT1 (NM_021951) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411862 DMRT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411862 Transient overexpression lysate of doublesex and mab-3 related transcription factor 1 (DMRT1) 100 ug
$436.00
TP308108 Recombinant protein of human doublesex and mab-3 related transcription factor 1 (DMRT1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.