SLAP2 (SLA2) (NM_032214) Human Mass Spec Standard

SKU
PH308103
SLA2 MS Standard C13 and N15-labeled recombinant protein (NP_115590)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208103]
Predicted MW 28.6 kDa
Protein Sequence
Protein Sequence
>RC208103 protein sequence
Red=Cloning site Green=Tags(s)

MGSLPSRRKSLPSPSLSSSVQGQGPVTMEAERSKATAVALGSFPAGGPAELSLRLGEPLTIVSEDGDWWT
VLSEVSGREYNIPSVHVAKVSHGWLYEGLSREKAEELLLLPGNPGGAFLIRESQTRRGSYSLSVRLSRPA
SWDRIRHYRIHCLDNGWLYISPRLTFPSLQALVDHYSELADDICCLLKEPCVLQRAGPLPGKDIPLPVTV
QRTPLNWKELDSSLLFSEAATGEESLLSEGLRESLSFYISLNDEAVSLDDA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115590
RefSeq Size 2569
RefSeq ORF 783
Synonyms C20orf156; MARS; SLAP-2; SLAP2
Locus ID 84174
UniProt ID Q9H6Q3
Cytogenetics 20q11.23
Summary This gene encodes a member of the SLAP family of adapter proteins. The encoded protein may play an important receptor-proximal role in downregulating T and B cell-mediated responses and inhibits antigen receptor-induced calcium mobilization. This protein interacts with Cas-Br-M (murine) ecotropic retroviral transforming sequence c. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:SLAP2 (SLA2) (NM_032214) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC406314 SLA2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC410277 SLA2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406314 Transient overexpression lysate of Src-like-adaptor 2 (SLA2), transcript variant 2 100 ug
$436.00
LY410277 Transient overexpression lysate of Src-like-adaptor 2 (SLA2), transcript variant 1 100 ug
$436.00
TP308103 Recombinant protein of human Src-like-adaptor 2 (SLA2), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.