FOXP4 (NM_138457) Human Mass Spec Standard

SKU
PH308077
FOXP4 MS Standard C13 and N15-labeled recombinant protein (NP_612466)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208077]
Predicted MW 72.2 kDa
Protein Sequence
Protein Sequence
>RC208077 protein sequence
Red=Cloning site Green=Tags(s)

MMVESASETIRSAPSGQNGVGSLSGQADGSSGGATGTTASGTGREVTTGADSNGEMSPAELLHFQQQQAL
QVARQFLLQQASGLSSPGNNDSKQSASAVQVPVSVAMMSPQMLTPQQMQQILSPPQLQALLQQQQALMLQ
QLQEYYKKQQEQLHLQLLTQQQAGKPQPKEALGNKQLAFQQQLLQMQQLQQQHLLNLQRQGLVSLQPNQA
SGPLQTLPQAVCPTDLPQLWKGEGAPGQPAEDSVKQEGLDLTGTAATATSFAAPPKVSPPLSHHTLPNGQ
PTVLTSRRDSSSHEETPGSHPLYGHGECKWPGCETLCEDLGQFIKHLNTEHALDDRSTAQCRVQMQVVQQ
LEIQLAKESERLQAMMAHLHMRPSEPKPFSQPVTVSAADSFPDGLVHPPTSAAAPVTPLRPPGLGSASLH
GGGPARRRSSDKFCSPISSELAQNHEFYKNADVRPPFTYASLIRQAILETPDRQLTLNEIYNWFTRMFAY
FRRNTATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEREYQKRRPPKMTGSPTLVKNMISGLSYGALNAS
YQAALAESSFPLLNSPGMLNPGSASSLLPLSHDDVGAPVEPLPSNGSSSPPRLSPPQYSHQVQVKEEPAE
AEEDRQPGPPLGAPNPSASGPPEDRDLEEELPGEELS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_612466
RefSeq Size 5926
RefSeq ORF 2001
Synonyms hFKHLA
Locus ID 116113
UniProt ID Q8IVH2
Cytogenetics 6p21.1
Summary This gene belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Many members of the forkhead box gene family, including members of subfamily P, have roles in mammalian oncogenesis. This gene may play a role in the development of tumors of the kidney and larynx. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms. [provided by RefSeq, Jul 2008]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:FOXP4 (NM_138457) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH308611 FOXP4 MS Standard C13 and N15-labeled recombinant protein (NP_001012426) 10 ug
$3,255.00
LC408607 FOXP4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422862 FOXP4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408607 Transient overexpression lysate of forkhead box P4 (FOXP4), transcript variant 2 100 ug
$436.00
LY422862 Transient overexpression lysate of forkhead box P4 (FOXP4), transcript variant 1 100 ug
$436.00
TP308077 Recombinant protein of human forkhead box P4 (FOXP4), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP308611 Recombinant protein of human forkhead box P4 (FOXP4), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.