OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BPI (NM_001725) Human Mass Spec Standard

Be the first to review this product
SKU
PH308067
BPI MS Standard C13 and N15-labeled recombinant protein (NP_001716)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA349719 Rabbit Polyclonal Anti-BPI Antibody
100 ul
$205.00
LY400650 Transient overexpression lysate of bactericidal/permeability-increasing protein (BPI) (as WB positive control) 100 ug
$436.00

Other products for "BPI or NM_001725"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208067
Predicted MW 53.9 kDa
Protein Sequence
Protein Sequence
>RC208067 protein sequence
Red=Cloning site Green=Tags(s)

MRENLARGPCNAPRWASLMVLVAIGTAVTAAVNPGVVVRISQKGLDYASQQGTAALQKELKRIKIPDYSD
SFKIKHLGKGHYSFYSMDIREFQLPSSQISMVPNVGLKFSISNANIKISGKWKAQKRFLKMSGNFDLSIE
GMSISADLKLGSNPTSGKPTITCSSCSSHINSVHVHISKSKVGWLIQLFHKKIESALRNKMNSQVCEKVT
NSVSSKLQPYFQTLPVMTKIDSVAGINYGLVAPPATTAETLDVQMKGEFYSENHHNPPPFAPPVMEFPAA
HDRMVYLGLSDYFFNTAGLVYQEAGVLKMTLRDDMIPKESKFRLTTKFFGTFLPEVAKKFPNMKIQIHVS
ASTPPHLSVQPTGLTFYPAVDVQAFAVLPNSSLASLFLIGMHTTGSMEVSAESNRLVGELKLDRLLLELK
HSNIGPFPVELLQDIMNYIVPILVLPRVNEKLQKGFPLPTPARVQLYNVVLQPHQNFLLFGADVVYK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001716
RefSeq Size 1901
RefSeq ORF 1461
Synonyms BPIFD1; rBPI
Locus ID 671
UniProt ID P17213
Cytogenetics 20q11.23
Summary This gene encodes a lipopolysaccharide binding protein. It is associated with human neutrophil granules and has antimicrobial activity against gram-negative organisms. provided by RefSeq, Nov 2014
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "BPI" proteins (4)
SKU Description Size Price
LC400650 Lyophilized BPI HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400650 Transient overexpression lysate of bactericidal/permeability-increasing protein (BPI) (as WB positive control) 100 ug
$436.00
TP308067 Recombinant protein of human bactericidal/permeability-increasing protein (BPI), 20 µg 20 ug
$867.00
TP721094 Purified recombinant protein of Human bactericidal/permeability-increasing protein (BPI) 10 ug
$260.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products