BPI (NM_001725) Human Mass Spec Standard

SKU
PH308067
BPI MS Standard C13 and N15-labeled recombinant protein (NP_001716)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208067]
Predicted MW 53.9 kDa
Protein Sequence
Protein Sequence
>RC208067 protein sequence
Red=Cloning site Green=Tags(s)

MRENLARGPCNAPRWASLMVLVAIGTAVTAAVNPGVVVRISQKGLDYASQQGTAALQKELKRIKIPDYSD
SFKIKHLGKGHYSFYSMDIREFQLPSSQISMVPNVGLKFSISNANIKISGKWKAQKRFLKMSGNFDLSIE
GMSISADLKLGSNPTSGKPTITCSSCSSHINSVHVHISKSKVGWLIQLFHKKIESALRNKMNSQVCEKVT
NSVSSKLQPYFQTLPVMTKIDSVAGINYGLVAPPATTAETLDVQMKGEFYSENHHNPPPFAPPVMEFPAA
HDRMVYLGLSDYFFNTAGLVYQEAGVLKMTLRDDMIPKESKFRLTTKFFGTFLPEVAKKFPNMKIQIHVS
ASTPPHLSVQPTGLTFYPAVDVQAFAVLPNSSLASLFLIGMHTTGSMEVSAESNRLVGELKLDRLLLELK
HSNIGPFPVELLQDIMNYIVPILVLPRVNEKLQKGFPLPTPARVQLYNVVLQPHQNFLLFGADVVYK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001716
RefSeq Size 1901
RefSeq ORF 1461
Synonyms BPIFD1; rBPI
Locus ID 671
UniProt ID P17213
Cytogenetics 20q11.23
Summary This gene encodes a lipopolysaccharide binding protein. It is associated with human neutrophil granules and has antimicrobial activity against gram-negative organisms. [provided by RefSeq, Nov 2014]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:BPI (NM_001725) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400650 BPI HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400650 Transient overexpression lysate of bactericidal/permeability-increasing protein (BPI) 100 ug
$436.00
TP308067 Recombinant protein of human bactericidal/permeability-increasing protein (BPI), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP721094 Purified recombinant protein of Human bactericidal/permeability-increasing protein (BPI) 10 ug
$250.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.