SURF5 (MED22) (NM_181491) Human Mass Spec Standard

SKU PH308015

MED22 MS Standard C13 and N15-labeled recombinant protein (NP_852468)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC208015]
• Predicted MW: 16.5 kDa
• Protein Sequence:
  Protein Sequence

  >RC208015 protein sequence; Red=Cloning site Green=Tags(s); ; MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVR; AGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRTLQEECDRKLITLRDEISIDLYELEEEYYSSRYK; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_852468
• RefSeq Size: 3910
• RefSeq ORF: 420
• Synonyms: MED24; SRB6; surf-5; SURF5
• Locus ID: 6837
• UniProt ID: Q15528
• Cytogenetics: 9q34.2
• Summary: This gene encodes a protein component of the mediator complex, which functions in the regulation of transcription by bridging interactions between gene-specific regulatory factors, RNA polymerase II, and general transcription factors. Alternatively spliced transcript variants encoding different isoforms have been observed. [provided by RefSeq, Jul 2013]