REM (REM1) (NM_014012) Human Mass Spec Standard

SKU
PH308010
REM1 MS Standard C13 and N15-labeled recombinant protein (NP_054731)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208010]
Predicted MW 32.9 kDa
Protein Sequence
Protein Sequence
>RC208010 protein sequence
Red=Cloning site Green=Tags(s)

MTLNTEQEAKTPLHRRASTPLPLSPRGHQPGRLSTVPSTQSQHPRLGQSASLNPPTQKPSPAPDDWSSES
SDSEGSWEALYRVVLLGDPGVGKTSLASLFAGKQERDLHEQLGEDVYERTLTVDGEDTTLVVVDTWEAEK
LDKSWSQESCLQGGSAYVIVYSIADRGSFESASELRIQLRRTHQADHVPIILVGNKADLARCREVSVEEG
RACAVVFDCKFIETSATLQHNVAELFEGVVRQLRLRRRDSAAKEPPAPRRPASLAQRARRFLARLTARSA
RRRALKARSKSCHNLAVL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_054731
RefSeq Size 1689
RefSeq ORF 894
Synonyms GD:REM; GES
Locus ID 28954
UniProt ID O75628
Cytogenetics 20q11.21
Summary The protein encoded by this gene is a GTPase and member of the RAS-like GTP-binding protein family. The encoded protein is expressed in endothelial cells, where it promotes reorganization of the actin cytoskeleton and morphological changes in the cells. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:REM (REM1) (NM_014012) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC415518 REM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415518 Transient overexpression lysate of RAS (RAD and GEM)-like GTP-binding 1 (REM1) 100 ug
$436.00
TP308010 Recombinant protein of human RAS (RAD and GEM)-like GTP-binding 1 (REM1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.