p75 NGF Receptor (NGFR) (NM_002507) Human Mass Spec Standard

SKU
PH307966
NGFR MS Standard C13 and N15-labeled recombinant protein (NP_002498)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207966]
Predicted MW 45.2 kDa
Protein Sequence
Protein Sequence
>RC207966 protein sequence
Red=Cloning site Green=Tags(s)

MGAGATGRAMDGPRLLLLLLLGVSLGGAKEACPTGLYTHSGECCKACNLGEGVAQPCGANQTVCEPCLDS
VTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTGRCEACRVCEAGSGLVFSCQD
KQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLRECTRWADAECEEIPGRWITRSTPPEGSDSTAP
STQEPEAPPEQDLIASTVAGVVTTVMGSSQPVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQ
NKQGANSRPVNQTPPPEGEKLHSDSGISVDSQSLHDQQPHTQTASGQALKGDGGLYSSLPPAKREEVEKL
LNGSAGDTWRHLAGELGYQPEHIDSFTHEACPVRALLASWATQDSATLDALLAALRRIQRADLVESLCSE
STATSPV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002498
RefSeq Size 3420
RefSeq ORF 1281
Synonyms CD271; Gp80-LNGFR; p75(NTR); p75NTR; TNFRSF16
Locus ID 4804
UniProt ID P08138
Cytogenetics 17q21.33
Summary Nerve growth factor receptor contains an extracellular domain containing four 40-amino acid repeats with 6 cysteine residues at conserved positions followed by a serine/threonine-rich region, a single transmembrane domain, and a 155-amino acid cytoplasmic domain. The cysteine-rich region contains the nerve growth factor binding domain. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction, Neurotrophin signaling pathway
Write Your Own Review
You're reviewing:p75 NGF Receptor (NGFR) (NM_002507) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419286 NGFR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419286 Transient overexpression lysate of nerve growth factor receptor (TNFR superfamily, member 16) (NGFR) 100 ug
$436.00
TP307966 Recombinant protein of human nerve growth factor receptor (TNFR superfamily, member 16) (NGFR), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.