Neuroligin 3 (NLGN3) (NM_018977) Human Mass Spec Standard

SKU
PH307955
NLGN3 MS Standard C13 and N15-labeled recombinant protein (NP_061850)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207955]
Predicted MW 91.8 kDa
Protein Sequence
Protein Sequence
>RC207955 protein sequence
Red=Cloning site Green=Tags(s)

MWLRLGPPSLSLSPKPTVGRSLCLTLWFLSLALRASTQAPAPTVNTHFGKLRGARVPLPSEILGPVDQYL
GVPYAAPPIGEKRFLPPEPPPYWSGIRNATHFPPVCPQNIHTAVPEVMLPVWFTANLDIVATYIQEPNED
CLYLNVYVPTEDGSGAKKQGEDLADNDGDEDEDIRDSGAKPVMVYIHGGSYMEGTGNMIDGSILASYGNV
IVITLNYRVGVLGFLSTGDQAAKGNYGLLDQIQALRWVSENIAFFGGDPRRITVFGSGIGASCVSLLTLS
HHSEGLFQRAIIQSGSALSSWAVNYQPVKYTSLLADKVGCNVLDTVDMVDCLRQKSAKELVEQDIQPARY
HVAFGPVIDGDVIPDDPEILMEQGEFLNYDIMLGVNQGEGLKFVEGVVDPEDGVSGTDFDYSVSNFVDNL
YGYPEGKDTLRETIKFMYTDWADRDNPETRRKTLVALFTDHQWVEPSVVTADLHARYGSPTYFYAFYHHC
QSLMKPAWSDAAHGDEVPYVFGVPMVGPTDLFPCNFSKNDVMLSAVVMTYWTNFAKTGDPNKPVPQDTKF
IHTKANRFEEVAWSKYNPRDQLYLHIGLKPRVRDHYRATKVAFWKHLVPHLYNLHDMFHYTSTTTKVPPP
DTTHSSHITRRPNGKTWSTKRPAISPAYSNENAQGSWNGDQDAGPLLVENPRDYSTELSVTIAVGASILF
LNVLAFAALYYRKDKRRQEPLRQPSPQRGAWAPELGAAPEEELAALQLGPTHHECEASPPHDTLRLTALP
DYTLTLRRSPDDIPLMTPNTITMIPNSLVGLQTLHPYNTFAAGFNSTGLPHSHSTTRV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_061850
RefSeq Size 3935
RefSeq ORF 2484
Synonyms HNL3
Locus ID 54413
UniProt ID Q9NZ94
Cytogenetics Xq13.1
Summary This gene encodes a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. Mutations in this gene may be associated with autism and Asperger syndrome. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Oct 2009]
Protein Families Druggable Genome, Transmembrane
Protein Pathways Cell adhesion molecules (CAMs)
Write Your Own Review
You're reviewing:Neuroligin 3 (NLGN3) (NM_018977) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402722 NLGN3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402722 Transient overexpression lysate of neuroligin 3 (NLGN3), transcript variant 2 100 ug
$436.00
TP307955 Recombinant protein of human neuroligin 3 (NLGN3), 20 µg 20 ug
$867.00
TP762438 Purified recombinant protein of Human neuroligin 3 (NLGN3), transcript variant 2, Tyr612-End, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$226.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.