APLF (NM_173545) Human Mass Spec Standard

SKU
PH307936
APLF MS Standard C13 and N15-labeled recombinant protein (NP_775816)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207936]
Predicted MW 57 kDa
Protein Sequence
Protein Sequence
>RC207936 protein sequence
Red=Cloning site Green=Tags(s)

MSGGFELQPRDGGPRVALAPGETVIGRGPLLGITDKRVSRRHAILEVAGGQLRIKPIHTNPCFYQSSEKS
QLLPLKPNLWCYLNPGDSFSLLVDKYIFRILSIPSEVEMQCTLRNSQVLDEDNILNETPKSPVINLPHET
TGASQLEGSTEIAKTQMTPTNSVSFLGENRDCNKQQPILAERKRILPTWMLAEHLSDQNLSVPAISGGNV
IQGSGKEEICKDKSQLNTTQQGRRQLISSGSSENTSAEQDTGEECKNTDQEESTISSKEMPQSFSAITLS
NTEMNNIKTNAQRNKLPIEELGKVSKHKIATKRTPHKEDEAMSCSENCSSAQGDSLQDESQGSHSESSSN
PSNPETLHAKATDSVLQGSEGNKVKRTSCMYGANCYRKNPVHFQHFSHPGDSDYGGVQIVGQDETDDRPE
CPYGPSCYRKNPQHKIEYRHNTLPVRNVLDEDNDNVGQPNEYDLNDSFLDDEEEDYEPTDEDSDWEPGKE
DEEKEDVEELLKEAKRFMKRK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_775816
RefSeq Size 3869
RefSeq ORF 1533
Synonyms APFL; C2orf13; PALF; Xip1; ZCCHH1
Locus ID 200558
UniProt ID Q8IW19
Cytogenetics 2p13.3
Summary C2ORF13 is a component of the cellular response to chromosomal DNA single- and double-strand breaks (Iles et al., 2007 [PubMed 17353262]).[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:APLF (NM_173545) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC406456 APLF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406456 Transient overexpression lysate of aprataxin and PNKP like factor (APLF) 100 ug
$436.00
TP307936 Recombinant protein of human aprataxin and PNKP like factor (APLF), 20 µg 20 ug
$737.00
TP710318 Purified recombinant protein of Human aprataxin and PNKP like factor (APLF), full length, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$515.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.