IGJ (JCHAIN) (NM_144646) Human Mass Spec Standard

SKU PH307932

IGJ MS Standard C13 and N15-labeled recombinant protein (NP_653247)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC207932]
• Predicted MW: 18.1 kDa
• Protein Sequence:
  Protein Sequence

  >RC207932 protein sequence; Red=Cloning site Green=Tags(s); ; MKNHLLFWGVLAVFIKAVHVKAQEDERIVLVDNKCKCARITSRIIRSSEDPNEDIVERNIRIIVPLNNRE; NISDPTSPLRTRFVYHLSDLCKKCDPTEVELDNQIVTATQSNICDEDSATETCYTYDRNKCYTAVVPLVY; GGETKMVETALTPDACYPD; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_653247
• RefSeq Size: 1413
• RefSeq ORF: 477
• Synonyms: IGCJ; IGJ; JCH
• Locus ID: 3512
• UniProt ID: P01591
• Cytogenetics: 4q13.3
• Summary: Serves to link two monomer units of either IgM or IgA. In the case of IgM, the J chain-joined dimer is a nucleating unit for the IgM pentamer, and in the case of IgA it induces larger polymers. It also help to bind these immunoglobulins to secretory component.[UniProtKB/Swiss-Prot Function]