OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MD1 (LY86) (NM_004271) Human Mass Spec Standard

Be the first to review this product
SKU
PH307913
LY86 MS Standard C13 and N15-labeled recombinant protein (NP_004262)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA306329 Rabbit Polyclonal MD-1 Antibody
100 ug
$640.00
LY401367 Transient overexpression lysate of lymphocyte antigen 86 (LY86) (as WB positive control) 100 ug
$436.00

Other products for "MD1 or NM_004271"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC207913
Predicted MW 17.9 kDa
Protein Sequence
Protein Sequence
>RC207913 protein sequence
Red=Cloning site Green=Tags(s)

MKGFTATLFLWTLIFPSCSGGGGGKAWPTHVVCSDSGLEVLYQSCDPLQDFGFSVEKCSKQLKSNINIRF
GIILREDIKELFLDLALMSQGSSVLNFSYPICEAALPKFSFCGRRKGEQIYYAGPVNNPEFTIPQGEYQV
LLELYTEKRSTVACANATIMCS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004262
RefSeq Size 895
RefSeq ORF 486
Synonyms dJ80N2.1; MD-1; MD1; MMD-1
Locus ID 9450
UniProt ID O95711
Cytogenetics 6p25.1
Summary May cooperate with CD180 and TLR4 to mediate the innate immune response to bacterial lipopolysaccharide (LPS) and cytokine production. Important for efficient CD180 cell surface expression (By similarity).UniProtKB/Swiss-Prot Function
Protein Families Secreted Protein
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MD1" proteins (3)
SKU Description Size Price
LC401367 Lyophilized LY86 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401367 Transient overexpression lysate of lymphocyte antigen 86 (LY86) (as WB positive control) 100 ug
$436.00
TP307913 Recombinant protein of human lymphocyte antigen 86 (LY86), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products