MD1 (LY86) (NM_004271) Human Mass Spec Standard

SKU
PH307913
LY86 MS Standard C13 and N15-labeled recombinant protein (NP_004262)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC207913]
Predicted MW 17.9 kDa
Protein Sequence
Protein Sequence
>RC207913 protein sequence
Red=Cloning site Green=Tags(s)

MKGFTATLFLWTLIFPSCSGGGGGKAWPTHVVCSDSGLEVLYQSCDPLQDFGFSVEKCSKQLKSNINIRF
GIILREDIKELFLDLALMSQGSSVLNFSYPICEAALPKFSFCGRRKGEQIYYAGPVNNPEFTIPQGEYQV
LLELYTEKRSTVACANATIMCS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004262
RefSeq Size 895
RefSeq ORF 486
Synonyms dJ80N2.1; MD-1; MD1; MMD-1
Locus ID 9450
UniProt ID O95711
Cytogenetics 6p25.1
Summary May cooperate with CD180 and TLR4 to mediate the innate immune response to bacterial lipopolysaccharide (LPS) and cytokine production. Important for efficient CD180 cell surface expression (By similarity).[UniProtKB/Swiss-Prot Function]
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:MD1 (LY86) (NM_004271) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401367 LY86 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401367 Transient overexpression lysate of lymphocyte antigen 86 (LY86) 100 ug
$436.00
TP307913 Recombinant protein of human lymphocyte antigen 86 (LY86), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.