PFD6 (PFDN6) (NM_014260) Human Mass Spec Standard

SKU PH307901

PFDN6 MS Standard C13 and N15-labeled recombinant protein (NP_055075)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC207901]
• Predicted MW: 14.6 kDa
• Protein Sequence:
  Protein Sequence

  >RC207901 protein sequence; Red=Cloning site Green=Tags(s); ; MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALLDGSNVVFKLLGPVLVKQELG; EARATVGKRLDYITAEIKRYESQLRDLERQSEQQRETLAQLQQEFQRAQAAKAGAPGKA; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_055075
• RefSeq Size: 602
• RefSeq ORF: 387
• Synonyms: H2-KE2; HKE2; KE-2; PFD6
• Locus ID: 10471
• UniProt ID: O15212
• Cytogenetics: 6p21.32
• Summary: PFDN6 is a subunit of the heteromeric prefoldin complex that chaperones nascent actin (see MIM 102560) and alpha- and beta-tubulin (see MIM 602529 and MIM 191130, respectively) chains pending their transfer to the cytosolic chaperonin containing TCP1 (MIM 186980) (CCT) complex (Hansen et al., 1999 [PubMed 10209023]).[supplied by OMIM, Jul 2010]
• Protein Families: Stem cell - Pluripotency